Align Methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate WP_057509133.1 ABB28_RS13605 enoyl-CoA hydratase-related protein
Query= reanno::pseudo5_N2C3_1:AO356_01590 (273 letters) >NCBI__GCF_001431535.1:WP_057509133.1 Length = 262 Score = 202 bits (513), Expect = 8e-57 Identities = 116/244 (47%), Positives = 149/244 (61%) Query: 18 TLWLSRESKNNAFNAEMIRELILALDHVSSDPNLRFLLIRGRGKHFSAGADLAWMQQSAE 77 TL L R + +NAF+ +I EL ALD DP++R +++ G G FSAGADL WM+ A Sbjct: 15 TLRLHRPALHNAFDDGLIAELTHALDQAGRDPSVRAVVLAGEGASFSAGADLQWMRGMAA 74 Query: 78 LDYHTNLDDARELAELMYNLAKLKIPTLAVVQGAAFGGALGLISACDMAIGADEAQFCLS 137 N DA LA LM L +L PTLA V G+AFGG +GL++ CD+AI AD A+F L+ Sbjct: 75 ASESENRQDALALARLMRTLDELPKPTLARVHGSAFGGGVGLVACCDIAIAADSARFGLT 134 Query: 138 EVRIGLAPAVISPFVVQAIGERAARRYALTAERFDGQRAKEIGLLSESYPVETLDQQVEQ 197 E R+GL PAVISP+V+ AIG R ARR+ T E+FD A IGL+ + LD VEQ Sbjct: 135 ESRLGLLPAVISPYVIAAIGTRQARRWFATGEQFDAATALRIGLVHAVVADDQLDAAVEQ 194 Query: 198 WIDNLLLNSPAAMRASKELLREVGNGALTPALRRYTENAIARIRVSPEGQEGLRAFLQKR 257 + L+ P A ++K L+R+V A + IAR+RVS EGQEGL AFL KR Sbjct: 195 QLALLMAAGPVAAASAKALVRQVVVSHDPDARDQANAELIARLRVSAEGQEGLGAFLGKR 254 Query: 258 APNW 261 P W Sbjct: 255 RPGW 258 Lambda K H 0.318 0.133 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 262 Length adjustment: 25 Effective length of query: 248 Effective length of database: 237 Effective search space: 58776 Effective search space used: 58776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory