Align L-piperidine-6-carboxylate dehydrogenase; EC 1.2.1.21 (characterized, see rationale)
to candidate WP_057508189.1 ABB28_RS08325 bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase PutA
Query= uniprot:Q88CC3 (496 letters) >NCBI__GCF_001431535.1:WP_057508189.1 Length = 892 Score = 126 bits (316), Expect = 4e-33 Identities = 99/299 (33%), Positives = 136/299 (45%), Gaps = 11/299 (3%) Query: 11 VAAEAYTQGDYPVHTPIDGSQIASVKLLGKAETIAR-IDQAQSAFEAWRSVPAPRRGELV 69 V T PV P D Q+ A T+ + + A +A AW PA R ++ Sbjct: 591 VPGATVTGASLPVTNPADTRQVVGHWQAADAATVQKALANAVAAQPAWNRTPATSRAAIL 650 Query: 70 RLFGEVLREHKADLGELVSIEAGKITQEGLGEVQEMIDICDFAVGLSRQLYGLTIASERP 129 + L A+ L EAGK +G+ EV+E +D + +R+ + P Sbjct: 651 EHAADQLEARIAEFMALCVKEAGKSLPDGVAEVREAVDFLRYYAKQAREQFAHAEKLPSP 710 Query: 130 GHHMRETW-HPLGVVGVISAFNFPVAVWAWNTALALVAGNSVVWKPSEKTPLTALACQAL 188 E H GV IS +NFP+A++ A AL AGNSV+ KP+E+T L L Sbjct: 711 TGESNELQLHGRGVFVCISPWNFPLAIFLGQVAAALAAGNSVIAKPAEQTNLIGYYAVKL 770 Query: 189 FEKALKAFGDAPAGLAQLVIG-GREAGEAMVDDPRVPLVSATGSTRMGREVGPRVAAR-- 245 A P G+ Q + G G G A+ DPRV V+ TGST R + +AAR Sbjct: 771 LLDA-----GVPEGVLQFLPGDGATVGAALTADPRVAGVAFTGSTDTARAINRAMAARDA 825 Query: 246 -FGRSILELGGNNAMILAPSADLDLAVRGILFSAVGTAGQRCTTLRRLIVHRSIKDEVV 303 G I E GG NA I SA + V+ + SA +AGQRC+ R L V I D+V+ Sbjct: 826 AIGVLIAETGGQNAFIADSSALPEQLVKDAIGSAFTSAGQRCSAARVLFVQDDIADKVM 884 Lambda K H 0.318 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 947 Number of extensions: 47 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 496 Length of database: 892 Length adjustment: 38 Effective length of query: 458 Effective length of database: 854 Effective search space: 391132 Effective search space used: 391132 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory