Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_057507764.1 ABB28_RS05960 polyamine ABC transporter ATP-binding protein
Query= BRENDA::Q70HW1 (384 letters) >NCBI__GCF_001431535.1:WP_057507764.1 Length = 378 Score = 204 bits (518), Expect = 4e-57 Identities = 126/312 (40%), Positives = 176/312 (56%), Gaps = 14/312 (4%) Query: 21 VKDFNLDIQDKEFTVFVGPSGCGKTTTLRMIAGLEDITEGNLYIGDRRVNDVPPKDRDIA 80 V D NLD++ E +G SG GK+T LR + G E T G++ + + + +PP R + Sbjct: 36 VDDVNLDVRKGEIFALLGGSGSGKSTLLRCLGGFETPTRGSIVLDGQPLVALPPYKRPVN 95 Query: 81 MVFQNYALYPHMTVYQNMAFGLKLRKVPKAEIDRRVQEAAKILDIAHLLDRKPKALSGGQ 140 M+FQ+YAL+PHM+V QN+AFGLK + I RRV E +++ + L R+P LSGGQ Sbjct: 96 MMFQSYALFPHMSVEQNIAFGLKQDGLAGDAIRRRVGEMLELVHMTSLAKRRPHQLSGGQ 155 Query: 141 RQRVALGRAIVREPQVFLMDEPLSNLDAKLRVQMRAEIRKLHQRLQTTVIYVTHDQTEAM 200 +QRVAL R++ + P++ L+DEP+ LD KLR QM+ E+ + + T + VTHDQ EAM Sbjct: 156 QQRVALARSLAKGPKLLLLDEPMGALDKKLRSQMQLELVNIIETSGVTCVMVTHDQEEAM 215 Query: 201 TMGDRIVVMRDGVIQQADTPQVVYSQPKNMFVAGFIGSPAMNFIRGEIVQDGDAFY-FRA 259 TM RI VM G IQQ P VY QP N FVAGFIGS +N G I +D + R+ Sbjct: 216 TMATRIAVMDAGWIQQVGKPDEVYEQPANRFVAGFIGS--VNSFEGVIDEDLPEYVTVRS 273 Query: 260 PSISLRLPEGRYGVLKASGAIGKPVVLGVRPEDL---HDEEVFMTTYPDSVLQMQVEVVE 316 P+ + G +G+ G+PV VRPE + DE T V +E + Sbjct: 274 PAFPAPIYIG-HGITCYE---GQPVAFAVRPEKIIIGKDEPEGHTNKAQGV----IEDIA 325 Query: 317 HMGSEVYLHTSI 328 + GS H + Sbjct: 326 YFGSHSVYHVRL 337 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 378 Length adjustment: 30 Effective length of query: 354 Effective length of database: 348 Effective search space: 123192 Effective search space used: 123192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory