Align 3-oxopimeloyl-CoA:CoA acetyltransferase (characterized)
to candidate WP_057508480.1 ABB28_RS09885 3-oxoadipyl-CoA thiolase
Query= metacyc::MONOMER-20679 (395 letters) >NCBI__GCF_001431535.1:WP_057508480.1 Length = 402 Score = 251 bits (640), Expect = 3e-71 Identities = 164/413 (39%), Positives = 221/413 (53%), Gaps = 30/413 (7%) Query: 1 MTEAVIVSTARTPIGKAYRGALNATEGATLLGHAIEHAVKR-AGIDPKEVEDVVMGAAMQ 59 M + I+ RTPIG+ Y GAL L ++ + R G+DP +E+V +G Q Sbjct: 1 MHDTYIIDGIRTPIGR-YAGALAGVRADDLGAIPLQALLARHPGLDPALIEEVYLGCTNQ 59 Query: 60 QGATGGNIARKALLRAGLPVTTAGTTIDRQCASGLQAIALAARSVLFDGVEIAVGGGGES 119 G N+AR +LL AGLPVT G+T++R C SGL AI AR + + +A+ GG ES Sbjct: 60 AGEDNRNVARMSLLLAGLPVTVPGSTVNRLCGSGLDAIGTVARGIAAGELGLAIAGGVES 119 Query: 120 ISL----------------VQNDKMNTFHAVDPALEAIKGDVYMAMLDTAETVAKRYGIS 163 +S V D + ++P L + G M TAE VA+R+ IS Sbjct: 120 MSRAPMVMGKAGTPFARDQVLEDTTMGWRFINPRLRELHGVETMGQ--TAENVAERHAIS 177 Query: 164 RERQDEYSLESQRRTAAAQQGGKFNDEIAPISTKMGVVDKATGAVSFKDITLSQDEGPRP 223 RE QD ++L SQ+R AAAQQ G F+ EI + G + + + DE PR Sbjct: 178 REDQDRFALRSQQRAAAAQQAGFFDGEIIAVDVP--------GRRRGETVRVEHDEHPRA 229 Query: 224 ETTAEGLAGLKAVRGEGFTITAGNASQLSDGASATVIMSDKTAAAKGLKPLGIFRGMVSY 283 +TT E LA LK + + ++TAGNAS ++DGA+A ++ S A GL P G S Sbjct: 230 DTTLEALARLKPLFRQPGSVTAGNASGINDGAAALLLASAAQVQALGLTPRARILGFASA 289 Query: 284 GCEPDEMGIGPVFAVPRLLKRHGLSVDDIGLWELNEAFAVQVLYCRDKLGI--DPEKLNV 341 G EP MG+GPV A RLL R GLS+ D ELNEAFA Q L C +LG+ D +N Sbjct: 290 GVEPSVMGMGPVPATRRLLARLGLSIADFDAIELNEAFASQGLACLRELGLADDAPHVNA 349 Query: 342 NGGAISVGHPYGMSGARLAGHALIEGRRRKAKYAVVTMCVGGGMGSAGLFEIV 394 NGGAI++GHP GMSGAR+A + + + + TMC+G G G A E V Sbjct: 350 NGGAIALGHPLGMSGARIALTLMRQLEASGGRRGLATMCIGVGQGVALAIERV 402 Lambda K H 0.316 0.134 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 448 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 402 Length adjustment: 31 Effective length of query: 364 Effective length of database: 371 Effective search space: 135044 Effective search space used: 135044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory