Align aldehyde dehydrogenase-like protein yneI (characterized)
to candidate WP_057508189.1 ABB28_RS08325 bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase PutA
Query= CharProtDB::CH_024181 (462 letters) >NCBI__GCF_001431535.1:WP_057508189.1 Length = 892 Score = 107 bits (268), Expect = 1e-27 Identities = 86/291 (29%), Positives = 128/291 (43%), Gaps = 16/291 (5%) Query: 2 TITPATHAISINPATGEQLSVLPWAGAD--DIENALQLAAAGFRDWRETNIDYRAEKLRD 59 T+T A+ ++ NPA Q+ V W AD ++ AL A A W T RA L Sbjct: 595 TVTGASLPVT-NPADTRQV-VGHWQAADAATVQKALANAVAAQPAWNRTPATSRAAILEH 652 Query: 60 IGKALRARSEEMAQMITREMGKPINQARAEVAKSANLCDWYAEHGPAMLK-----AEPTL 114 L AR E + +E GK + AEV ++ + +YA+ PT Sbjct: 653 AADQLEARIAEFMALCVKEAGKSLPDGVAEVREAVDFLRYYAKQAREQFAHAEKLPSPTG 712 Query: 115 VENQQAVIEYRPLGTILAIMPWNFPLWQVMRGAVPIILAGNGYLLKHAPNVMGCAQLIAQ 174 N+ ++ G + I PWNFPL + + AGN + K A + Sbjct: 713 ESNE---LQLHGRGVFVCISPWNFPLAIFLGQVAAALAAGNSVIAKPAEQTNLIGYYAVK 769 Query: 175 VFKDAGIPQGVYGWLNADNDGV-SQMIKDSRIAAVTVTGSVRAGAAIG---AQAGAALKK 230 + DAG+P+GV +L D V + + D R+A V TGS AI A AA+ Sbjct: 770 LLLDAGVPEGVLQFLPGDGATVGAALTADPRVAGVAFTGSTDTARAINRAMAARDAAIGV 829 Query: 231 CVLELGGSDPFIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIIEEGIA 281 + E GG + FI + A E VK A+ + + GQ C+AA+ +++ IA Sbjct: 830 LIAETGGQNAFIADSSALPEQLVKDAIGSAFTSAGQRCSAARVLFVQDDIA 880 Lambda K H 0.319 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 830 Number of extensions: 43 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 462 Length of database: 892 Length adjustment: 38 Effective length of query: 424 Effective length of database: 854 Effective search space: 362096 Effective search space used: 362096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory