Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate WP_057507764.1 ABB28_RS05960 polyamine ABC transporter ATP-binding protein
Query= TCDB::P31134 (377 letters) >NCBI__GCF_001431535.1:WP_057507764.1 Length = 378 Score = 406 bits (1043), Expect = e-118 Identities = 215/357 (60%), Positives = 255/357 (71%) Query: 20 LEIRNLTKSYDGQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAGQIMLD 79 L IR+L K +DG AVDDV+L + KGEIFALLG SG GKSTLLR L GFE P+ G I+LD Sbjct: 21 LSIRDLRKEFDGFVAVDDVNLDVRKGEIFALLGGSGSGKSTLLRCLGGFETPTRGSIVLD 80 Query: 80 GVDLSQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDKLPKAEIASRVNEMLGLVHM 139 G L +PPY RP+NMMFQSYALFPHM+VEQNIAFGLKQD L I RV EML LVHM Sbjct: 81 GQPLVALPPYKRPVNMMFQSYALFPHMSVEQNIAFGLKQDGLAGDAIRRRVGEMLELVHM 140 Query: 140 QEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQLEVVDILERV 199 AKR+PHQLSGGQ+QRVALARSLAK PKLLLLDEPMGALDKKLR +MQLE+V+I+E Sbjct: 141 TSLAKRRPHQLSGGQQQRVALARSLAKGPKLLLLDEPMGALDKKLRSQMQLELVNIIETS 200 Query: 200 GVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTTRYSAEFIGSVNVFEGV 259 GVTCVMVTHDQEEAMTMA RIA+M+ G Q+G+P+E+YE P R+ A FIGSVN FEGV Sbjct: 201 GVTCVMVTHDQEEAMTMATRIAVMDAGWIQQVGKPDEVYEQPANRFVAGFIGSVNSFEGV 260 Query: 260 LKERQEDGLVLDSPGLVHPLKVDADASVVDNVPVHVALRPEKIMLCEEPPANGCNFAVGE 319 + E + + + SP P+ + + + PV A+RPEKI++ ++ P N A G Sbjct: 261 IDEDLPEYVTVRSPAFPAPIYIGHGITCYEGQPVAFAVRPEKIIIGKDEPEGHTNKAQGV 320 Query: 320 VIHIAYLGDLSVYHVRLKSGQMISAQLQNAHRHRKGLPTWGDEVRLCWEVDSCVVLT 376 + IAY G SVYHVRL SG + A N+ R TWGDEV + W + VVLT Sbjct: 321 IEDIAYFGSHSVYHVRLPSGAKVMANFANSQRWASDGLTWGDEVWVHWRDNDGVVLT 377 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 442 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 378 Length adjustment: 30 Effective length of query: 347 Effective length of database: 348 Effective search space: 120756 Effective search space used: 120756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory