Align putrescine transport system permease protein PotH (characterized)
to candidate WP_057507765.1 ABB28_RS05965 ABC transporter permease subunit
Query= CharProtDB::CH_088338 (317 letters) >NCBI__GCF_001431535.1:WP_057507765.1 Length = 303 Score = 366 bits (939), Expect = e-106 Identities = 177/295 (60%), Positives = 227/295 (76%), Gaps = 5/295 (1%) Query: 17 KLWLSQLQMKHGRKLVIALPYIWLILLFLLPFLIVFKISLAEMARAIPPYTELMEWADGQ 76 K W+ L R V+ +PY+WL+L F +PF+I+ IS A PPYT L+++ DG Sbjct: 7 KRWMPGL-----RDAVVGVPYLWLLLFFAVPFVIILMISFAHTQVGSPPYTWLLQYVDGA 61 Query: 77 LSITLNLGNFLQLTDDPLYFDAYLQSLQVAAISTFCCLLIGYPLAWAVAHSKPSTRNILL 136 L++ LNL N+LQL D Y AY+ S ++AAIST LLIGYP+A+A+A KPSTRNI++ Sbjct: 62 LALKLNLENYLQLVRDQQYVLAYVSSFKIAAISTVLTLLIGYPMAYAIARMKPSTRNIMM 121 Query: 137 LLVILPSWTSFLIRVYAWMGILKNNGVLNNFLLWLGVIDQPLTILHTNLAVYIGIVYAYV 196 +LV+LPSWTSFLIRVYAW+GIL NG+LN LL +G+IDQPL IL+T A YIGIVY Y+ Sbjct: 122 MLVVLPSWTSFLIRVYAWIGILDRNGLLNQLLLKIGLIDQPLQILYTPTAAYIGIVYCYL 181 Query: 197 PFMVLPIYTALIRIDYSLVEAALDLGARPLKTFFTVIVPLTKGGIIAGSMLVFIPAVGEF 256 PFMVLP+Y L++ D L+EAA DLGA+P + F + +PL++ GIIAG MLV IPAVGEF Sbjct: 182 PFMVLPLYANLVKHDQRLLEAAYDLGAKPWEAFLRITLPLSRAGIIAGCMLVMIPAVGEF 241 Query: 257 VIPELLGGPDSIMIGRVLWQEFFNNRDWPVASAVAIIMLLLLIVPIMWFHKHQQK 311 VIPE+LGGPD++MIGRVLW EFFNNR+WPVASAVA++MLLLL+VPI F++ QQ+ Sbjct: 242 VIPEMLGGPDTLMIGRVLWGEFFNNRNWPVASAVAVVMLLLLLVPIFLFNRSQQR 296 Lambda K H 0.328 0.144 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 303 Length adjustment: 27 Effective length of query: 290 Effective length of database: 276 Effective search space: 80040 Effective search space used: 80040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory