Align NAD(P)+-dependent L-rhamnose 1-dehydrogenase (EC 1.1.1.378; EC 1.1.1.173) (characterized)
to candidate WP_057506951.1 ABB28_RS01610 3-oxoacyl-ACP reductase FabG
Query= metacyc::MONOMER-16230 (256 letters) >NCBI__GCF_001431535.1:WP_057506951.1 Length = 247 Score = 147 bits (371), Expect = 2e-40 Identities = 97/246 (39%), Positives = 142/246 (57%), Gaps = 11/246 (4%) Query: 9 IVTGASRGIGRAAARECARQGARVVIGHSGSDEGRAGALSLAEEIAAFGGTAIAVGA-DA 67 +VTGASRGIG A A A QGA VIG + +D +GA ++ E +AA GG A+ DA Sbjct: 11 LVTGASRGIGAAIADLLAAQGA-TVIGTATTD---SGAAAIGERLAAQGGHGRALNVTDA 66 Query: 68 ADLDSGEKLVAAAVEAFGSVDVLVNNAGICPFHSFLDMPRELYLKTVGTNLNGAYFTVQA 127 A L E ++A + FG++ +LVNNAGI + + M E + + TNL + T +A Sbjct: 67 AAL---ETVLADIAKEFGAISILVNNAGITRDNLLMRMKDEDWASIIDTNLTSVFRTSKA 123 Query: 128 AARRMKEQGRGGAIIAVSSISALVGGAMQTHYTPTKAGLLSLMQSCAIALGPYGIRCNAV 187 R M + R G II ++S+ + G A Q +Y KAG++ +S A +G G+ N V Sbjct: 124 VMRGMMK-ARKGRIINIASVVGVTGNAGQANYAAAKAGIIGFSKSLAKEIGSRGVTVNVV 182 Query: 188 LPGTIATDINKEDLSDLEKRERMTSRVPLGRLGEPDDLAGPIVFLASDMARYVTGASLLV 247 PG I TD+ K L+D E R + + + L RLG P+D+A + FLA A Y+TG +L V Sbjct: 183 APGFIDTDMTKA-LTD-EARAALVNSIALERLGSPEDIAHAVAFLAGPAANYITGETLHV 240 Query: 248 DGGLFV 253 +GG+++ Sbjct: 241 NGGMYM 246 Lambda K H 0.319 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 247 Length adjustment: 24 Effective length of query: 232 Effective length of database: 223 Effective search space: 51736 Effective search space used: 51736 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory