Align sorbitol-6-phosphate dehydrogenase subunit (EC 1.1.1.140) (characterized)
to candidate WP_057506951.1 ABB28_RS01610 3-oxoacyl-ACP reductase FabG
Query= metacyc::MONOMER-13092 (266 letters) >NCBI__GCF_001431535.1:WP_057506951.1 Length = 247 Score = 117 bits (294), Expect = 2e-31 Identities = 87/263 (33%), Positives = 129/263 (49%), Gaps = 31/263 (11%) Query: 7 IAGKTVIVTGASSGIGKAIVDELLSLKVKVANFDLTDNGEKH--ENLLFQ-----KVDVT 59 + G+ +VTGAS GIG AI D L + V TD+G E L Q ++VT Sbjct: 5 LQGEIALVTGASRGIGAAIADLLAAQGATVIGTATTDSGAAAIGERLAAQGGHGRALNVT 64 Query: 60 SREQVEASVAAVVEHFGTVDAVVNNAGINIPRLLVDPKDPHGQYELDDATFEKITMINQK 119 +E +A + + FG + +VNNAGI LL+ KD +D N Sbjct: 65 DAAALETVLADIAKEFGAISILVNNAGITRDNLLMRMKDEDWASIIDT---------NLT 115 Query: 120 GLYLVSQAVGRLLVAKKKGVIINMASEAGLEGSEGQSAYAGTKAAVYSYTRSWAKELGKY 179 ++ S+AV R ++ +KG IIN+AS G+ G+ GQ+ YA KA + +++S AKE+G Sbjct: 116 SVFRTSKAVMRGMMKARKGRIINIASVVGVTGNAGQANYAAAKAGIIGFSKSLAKEIGSR 175 Query: 180 GVRVVGIAPGIMEATGLRTLAYEEALGYTRGKTVEEIRAGYASTTTTPLGRSGKLSEVAD 239 GV V +APG ++ + L +E RA A + L R G ++A Sbjct: 176 GVTVNVVAPGFIDTDMTKAL-------------TDEARA--ALVNSIALERLGSPEDIAH 220 Query: 240 LVAYYISDRSSYITGITTNVAGG 262 VA+ ++YITG T +V GG Sbjct: 221 AVAFLAGPAANYITGETLHVNGG 243 Lambda K H 0.313 0.131 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 247 Length adjustment: 24 Effective length of query: 242 Effective length of database: 223 Effective search space: 53966 Effective search space used: 53966 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory