Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate WP_057507779.1 ABB28_RS05820 enoyl-CoA hydratase-related protein
Query= BRENDA::A4YI89 (259 letters) >NCBI__GCF_001431535.1:WP_057507779.1 Length = 259 Score = 220 bits (560), Expect = 3e-62 Identities = 114/244 (46%), Positives = 162/244 (66%), Gaps = 1/244 (0%) Query: 17 ITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKG-KAFCAGADITQFNQLTP 75 +T+ RP+KLNALN + L L A QA DP +RV+I+TG G KAF AGADI++ N L+ Sbjct: 16 VTVQRPEKLNALNGETLRALAAAFEQAAQDPAVRVVILTGAGPKAFVAGADISEMNTLSA 75 Query: 76 AEAWKFSKKGREIMDKIEALSKPTIAMINGYALGGGLELALACDIRIAAEEAQLGLPEIN 135 E FS G+ +M +IE + KP IA +NG+ALGGGLELA+AC +RIA + A+LG PEI Sbjct: 76 VEGRDFSLLGQRLMRQIERMPKPVIARVNGFALGGGLELAMACHLRIAVDTARLGQPEIT 135 Query: 136 LGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLVNRVVPLANLEQETRKLA 195 LG+ PG+GG+QRL R+ G+ ALE+ + G I A + GLVN V +L+ LA Sbjct: 136 LGLIPGFGGSQRLLRLCGRAAALELCLLGTPIDAARALQLGLVNEVASADDLDARVAGLA 195 Query: 196 EKIAKKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVVFSTEDKKEGVSAFLEKREPT 255 E++A +P+++ + + V+ G + L SGL ES +G++F+T D +EG SAFLE+R Sbjct: 196 ERLANAAPLAVRALLDAVHVGGECSLESGLEYESAQFGLLFATHDMREGTSAFLERRAAM 255 Query: 256 FKGK 259 F+ + Sbjct: 256 FQNR 259 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 133 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 259 Length adjustment: 24 Effective length of query: 235 Effective length of database: 235 Effective search space: 55225 Effective search space used: 55225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory