Align chlorocatechol 1,2-dioxygenase 2 monomer (characterized)
to candidate WP_057508464.1 ABB28_RS09875 protocatechuate 3,4-dioxygenase subunit alpha
Query= metacyc::MONOMER-14665 (254 letters) >NCBI__GCF_001431535.1:WP_057508464.1 Length = 187 Score = 54.7 bits (130), Expect = 1e-12 Identities = 33/94 (35%), Positives = 47/94 (50%), Gaps = 7/94 (7%) Query: 76 GPYFIPGAPELSIPYTMPMRDDESGDTLIFRGEVVDQEGAPLADVLLDMWQADAAGEYSF 135 GPY+ G L P G+ + RG+V D G P++D +L++WQADA G Y+ Sbjct: 12 GPYYRLGLEPLYRTGIAP--PSALGERVEVRGQVFDGTGLPVSDAVLEIWQADAQGIYAH 69 Query: 136 INPTL-----PDYLFRGKIRTDENGRFTLRTIVP 164 P + G++ TDENGRF T+ P Sbjct: 70 AEDPRRDDHDPAFDGWGRVPTDENGRFAFSTVKP 103 Lambda K H 0.316 0.134 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 187 Length adjustment: 22 Effective length of query: 232 Effective length of database: 165 Effective search space: 38280 Effective search space used: 38280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory