Align 2-amino-5-chloromuconic acid deaminase; 2-aminomuconate deaminase; EC 3.5.99.5 (characterized)
to candidate WP_338063076.1 ABB28_RS15960 amidase
Query= SwissProt::Q38M35 (462 letters) >NCBI__GCF_001431535.1:WP_338063076.1 Length = 498 Score = 149 bits (377), Expect = 2e-40 Identities = 149/465 (32%), Positives = 198/465 (42%), Gaps = 32/465 (6%) Query: 6 LSLAEHAARLRRRELTAVALIDTCAQHHARMEPRLNAYKTWDGARARSAAAAVDTLLDQG 65 LS + +A LRR EL+AV L +C A + P +NA D A A AA D L +G Sbjct: 30 LSATDASALLRRGELSAVELTRSCLGRIAVVNPVVNALNFVDEAAAIRAAEQADAALARG 89 Query: 66 QDLGPLMGLPVSVKDLYGVPGLPVFAGSDEALPEAWQAAGPLVARLQRQLGIVVGKTHTV 125 PL G+PV++KD V G P+ G A P VARL+ IV+G+++T Sbjct: 90 AVSAPLHGIPVAIKDNTDVRGQPMTNGIVALKDNIASADAPQVARLRAAGAIVLGRSNTP 149 Query: 126 EFAFGGLGVNAHWGTPRNPWSPHEHRVPGGSSAGAGVSLVQGSALLALGTDTAGSVRVPA 185 F+F N GT NPWS PGGSS GA ++ G LA G D GS+R PA Sbjct: 150 CFSFSWDARNDLHGTTWNPWS--RAHTPGGSSGGAACAVATGMVPLAHGNDIGGSIRHPA 207 Query: 186 SMTGQVGLKTTVGR-----WPVEGIVPLSSSLDTA-GVLTRTVEDLAY---AFAALDTES 236 G GL+ T GR P +G L L G + R V DL + D Sbjct: 208 YCCGVAGLRPTPGRVPGLFSPAKGDEALGLQLMLVDGPIARGVADLRLMLESMTGFDPRV 267 Query: 237 QG-----LPAPAPVRVQGLRVGVPTNHFWDDIDPSIAAAVEAAVQRLAQAGAQVVRFPLP 291 G LP PA + G R+GV P++AAA+E AV L QAG V LP Sbjct: 268 PGSLPLPLPFPASPLLPGTRIGVLREDDVKPRTPTVAAALERAVVALQQAGFTVEEVRLP 327 Query: 292 HCEEAFDIFRRGGLAASELAAYL-----DQHFPHKVERLDPVVRDRVRWAEQVSSVEYLR 346 EA+ ++ L E A L D P K W Q S +Y+ Sbjct: 328 ELAEAWRLWWL--LVMEETRALLPSIERDGDAPIKAWIGFNYDVASEMWGRQPSLTDYIN 385 Query: 347 RKAVLQRCGAGAARLFDDVDVLLTPTVPASP----PRLADIGTVETYAPANMKAMRNTAI 402 A R A + V+L P P AD+ + + M AI Sbjct: 386 GYARRARLIASLQQKLRRYPVILMPVASEEPFKQGQHYADLASARAAIASGWPLM---AI 442 Query: 403 SNLFGWCALTMPVGLDANRMPVGLQLMGPPRAEARLIGIALGIEA 447 + G+ AL +P G + +P G+QLMG E ++ + +EA Sbjct: 443 P-VLGFPALAVPTGC-VDGLPTGVQLMGRRFHERDVLQVGAALEA 485 Lambda K H 0.320 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 543 Number of extensions: 37 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 462 Length of database: 498 Length adjustment: 34 Effective length of query: 428 Effective length of database: 464 Effective search space: 198592 Effective search space used: 198592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory