Align ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized)
to candidate WP_057508148.1 ABB28_RS08100 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::WCS417:GFF4321 (386 letters) >NCBI__GCF_001431535.1:WP_057508148.1 Length = 362 Score = 325 bits (833), Expect = 1e-93 Identities = 170/365 (46%), Positives = 239/365 (65%), Gaps = 5/365 (1%) Query: 1 MATLELRNVNKTYGAGLPDTLKNIELSIKEGEFLILVGPSGCGKSTLMNCIAGLETITGG 60 MA ++L+ V K Y G +K+ + +GE ++LVGPSGCGKSTL+ IAGLE I+GG Sbjct: 1 MAKVQLQGVRKVYDNGQV-AVKDATFEVADGELMVLVGPSGCGKSTLLRMIAGLEEISGG 59 Query: 61 AIMIGDQDVSGMSPKDRDIAMVFQSYALYPTMSVRENIEFGLKIRKMPQADIDAEVARVA 120 + IG++ V+ ++PKDRDIAMVFQSYALYP M+V EN+ FGLK+R +A ID ++ A Sbjct: 60 TLTIGERVVNDVAPKDRDIAMVFQSYALYPHMTVAENLAFGLKLRGHDKATIDKRISEAA 119 Query: 121 KLLQIEHLLNRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKL 180 + L + ++++ P +SGGQ+QRVA+GRAL R P ++L DEPLSNLDAKLR +RTE+ Sbjct: 120 QTLGLTDMMDKLPKAMSGGQRQRVALGRALVREPAVFLLDEPLSNLDAKLRHSVRTEIAQ 179 Query: 181 MHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKEIYNNPANQFVASFIGSPP 240 +H++L TT +YVTHDQ+EAMTLG ++ V+KDG+IQQ TP E+Y+ PAN FVA F+GSP Sbjct: 180 LHRKLGTTMIYVTHDQVEAMTLGQRIVVLKDGVIQQIDTPMELYDRPANLFVAGFLGSPA 239 Query: 241 MNFVPLRLQRKDGRLVALLDSGQARCELALNTTEAGLEDRDVILGLRPEQIMLAAGEGDS 300 MN + LQ +V + G + L T + D+ + +G+RPE + A + + Sbjct: 240 MNVLRGTLQASASGVV--VSDGDWKAPLGHATIDPRWLDKPIAVGVRPEHLQPA--DAGA 295 Query: 301 ASSIRAEVQVTEPTGPDTLVFVQLNDTKVCCRLAPDVAPQVGETLTLQFDPSKVLLFDAN 360 + A ++ EP G + V + + R+AP P VGETL L P+ + FDA Sbjct: 296 EWTFEARIEGIEPVGNEIFVNLVSGQHALTMRVAPRALPAVGETLKLAVQPNALHFFDAE 355 Query: 361 TGERL 365 TGERL Sbjct: 356 TGERL 360 Lambda K H 0.318 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 362 Length adjustment: 30 Effective length of query: 356 Effective length of database: 332 Effective search space: 118192 Effective search space used: 118192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory