Align 2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_083510176.1 AU252_RS00745 enoyl-CoA hydratase-related protein
Query= metacyc::MONOMER-15953 (257 letters) >NCBI__GCF_001484605.1:WP_083510176.1 Length = 279 Score = 164 bits (415), Expect = 2e-45 Identities = 114/263 (43%), Positives = 149/263 (56%), Gaps = 17/263 (6%) Query: 6 SVDAPEQG-VRLITLQRPEALNALNTQLLDELAAELALAEQDAETRAVVLTGSR-KAFAA 63 +V A E G V L+T+ RPEA NA+N ++ + L AE+ RAVV+TGS KAF A Sbjct: 21 AVTAEEIGHVFLVTINRPEARNAVNPDVIRGVGRALEHAEECPGIRAVVITGSGDKAFCA 80 Query: 64 GADIKEMAERDLVGIL-EDPRVAHWQRIAAF-----SKPLIAAVNGFCLGGGCELAMHAD 117 GAD+K A VG E P A F SKP IAA+NGF LGGG E+ + +D Sbjct: 81 GADLKSAA----VGAFGEIPEGMEQWGFAGFVKHHISKPTIAAINGFALGGGTEIVLASD 136 Query: 118 ILIAGEDARFGQPEINLGIMPGAGGTQRLLRAVGKSLAMQMVLSGQAIDARHAQRAGLVS 177 + IA +A FG PE+ LGI GAGG R + V K +AM+M+L+GQ + A+ A GLV+ Sbjct: 137 LAIASSEAVFGLPEVKLGIFAGAGGAFRAGQQVPKKIAMEMLLTGQPLPAQRALEIGLVN 196 Query: 178 EVTLPELTIERALAIARVIAQKAPLAVRLAKEALLKAED----TDLASGLRFERHAFTVL 233 V PE + AL +AR I + APLAV+ K D +D A R E A ++ Sbjct: 197 RVVPPEEVLPAALELARQICENAPLAVQTTKRIANGITDGTVESDQADWARSEWEAQKLM 256 Query: 234 AGTADRAEGIRAFQEKRRPEFTG 256 T D EG+RAF EKR P++ G Sbjct: 257 RST-DFMEGMRAFAEKRAPQWQG 278 Lambda K H 0.320 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 218 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 279 Length adjustment: 25 Effective length of query: 232 Effective length of database: 254 Effective search space: 58928 Effective search space used: 58928 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory