Align ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized)
to candidate WP_058932984.1 AU252_RS15205 amino acid ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_03045 (232 letters) >NCBI__GCF_001484605.1:WP_058932984.1 Length = 299 Score = 116 bits (291), Expect = 4e-31 Identities = 77/231 (33%), Positives = 119/231 (51%), Gaps = 20/231 (8%) Query: 1 MIFDYNVIWEALPLYF------GGLVTTLKLLALSLLFGLLAALPLGLMRVSKQPIVNMS 54 ++ + N W+ + YF G+ TL L LS+ ++ A+ L MR S P+ Sbjct: 30 LVTNTNFRWDIVGTYFMDVLVIQGIGWTLLLTVLSMAIAIMLAILLAFMRQSDNPLFRGV 89 Query: 55 AWLYTYVIRGTPMLVQLFLIYYGLAQ-----------FEAVRESFLWPWLSSATFCACLA 103 +W + + RGTP+ QL +++GL F SF + +A A L Sbjct: 90 SWTWVWFFRGTPVYTQL--VFWGLISVLYPKIALGIPFGPELFSFSTQDVITAFMAAILG 147 Query: 104 FAINTSAYTAEIIAGSLRATPNGEIEAAKAMGMSRFKMYKRILLPSALRRALPQYSNEVI 163 +N SAY AEI L++ +G++EAA+A+GM + K+ RI+LP A+R +P NE I Sbjct: 148 LGLNESAYLAEIFRAGLKSVDSGQMEAAEALGMRKSKIMWRIILPQAMRVIVPPTGNETI 207 Query: 164 MMLQTTSLASIVTL-IDITGAARTVNAQYYLPFEAYITAGVFYLCMTFILV 213 ML+TTSL V +D+T A + + YLP I A ++YL +T IL+ Sbjct: 208 GMLKTTSLVLAVPFTLDLTFATNGIANRSYLPIPLLIVAALWYLVITSILM 258 Lambda K H 0.329 0.139 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 299 Length adjustment: 25 Effective length of query: 207 Effective length of database: 274 Effective search space: 56718 Effective search space used: 56718 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory