Align Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 (characterized)
to candidate WP_058930874.1 AU252_RS11785 acetyl-CoA C-acetyltransferase
Query= SwissProt::P14611 (393 letters) >NCBI__GCF_001484605.1:WP_058930874.1 Length = 398 Score = 328 bits (840), Expect = 2e-94 Identities = 185/389 (47%), Positives = 250/389 (64%), Gaps = 2/389 (0%) Query: 5 VIVSAARTAVGKFGGSLAKIPAPELGAVVIKAALERAGVKPEQVSEVIMGQVLTAGSGQN 64 VI+ ART GKF GSL+ + + ELGA I+ ALER+GV PEQ+ VI+GQV+ AG+GQ Sbjct: 9 VILGGARTPFGKFRGSLSGLTSSELGAHAIRNALERSGVAPEQIQAVIVGQVIQAGAGQG 68 Query: 65 PARQAAIKAGLPAMVPAMTINKVCGSGLKAVMLAANAIMAGDAEIVVAGGQENMSAAPHV 124 PARQA++ AG+ VP +TINK+C SGL AV+ AA I AG+A+ +VA GQE+M+ APH+ Sbjct: 69 PARQASLAAGIGWDVPTVTINKLCLSGLTAVIDAARMIRAGEADFIVAAGQESMTNAPHL 128 Query: 125 LPGSRDGFRMGDAKLVDTMIVDGLWDVYNQYHMGITAENVAKEYGITREAQDEFAVGSQN 184 LP R G +GDA L+D++ DGL D + MG + GI+RE QD A S Sbjct: 129 LPRLRGGVAIGDAPLLDSLNFDGLQDPVSGELMGSATDAGNARLGISREDQDAVAALSHQ 188 Query: 185 KAEAAQKAGKFDEEIVPVLIPQRKGDPVAFKTDEFVRQGATLDSMSGLKPAF--DKAGTV 242 +AEAA+ AG EEI PV +PQR+G V DE +R G T+++++ LKPAF D A T+ Sbjct: 189 RAEAARAAGILAEEIAPVEVPQRRGPAVVIDADEGIRAGTTIETLAALKPAFSKDPAATI 248 Query: 243 TAANASGLNDGAAAVVVMSAAKAKELGLTPLATIKSYANAGVDPKVMGMGPVPASKRALS 302 TA +AS L+DGAAAVVV S A A+ GL+ +A I S+ + P A +RAL Sbjct: 249 TAGSASPLSDGAAAVVVASKAAAEAAGLSWIAEIGSHGQTAGPDGSLHSQPSRAIERALK 308 Query: 303 RAEWTPQDLDLMEINEAFAAQALAVHQQMGWDTSKVNVNGGAIAIGHPIGASGCRILVTL 362 T D+DL+EINEAFA+ L +G D ++N +GGAIA+GHP+GASG R+++ Sbjct: 309 LEGLTIDDVDLIEINEAFASVVLQSATDLGIDADRINADGGAIALGHPVGASGARLVLHQ 368 Query: 363 LHEMKRRDAKKGLASLCIGGGMGVALAVE 391 + RR G+ +LC GGG G AL ++ Sbjct: 369 ALALNRRGGGTGVVALCGGGGQGDALILK 397 Lambda K H 0.315 0.131 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 457 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 398 Length adjustment: 31 Effective length of query: 362 Effective length of database: 367 Effective search space: 132854 Effective search space used: 132854 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory