Align ABC transporter for D-Glucosamine, permease component 1 (characterized)
to candidate WP_058932847.1 AU252_RS08930 carbohydrate ABC transporter permease
Query= reanno::Smeli:SM_b21219 (281 letters) >NCBI__GCF_001484605.1:WP_058932847.1 Length = 305 Score = 151 bits (382), Expect = 1e-41 Identities = 91/270 (33%), Positives = 159/270 (58%), Gaps = 13/270 (4%) Query: 17 LLLAVVILA--PVAWLLIMSISPAADLSAKPLAWWPSDIDLSRYRTLLSAVENSAGAAFI 74 LL A +IL P +LL S D A P P + L Y L + + Sbjct: 44 LLAAAMILYGFPFLYLLFTSFKTPIDTIAVPPTILPREWTLENYTNALGR------SGVL 97 Query: 75 ASLLNSIKVAGMATLAAVVVAVPAAWAVSR--TPAVAWSLYAVIATYMLPPVALAVPLYM 132 AS +NS + A ++T+ ++V+AVPAA+ ++R TP+ + A + T M+PPVA+ +PL Sbjct: 98 ASFINSAQTAIISTVLSLVLAVPAAYGITRYKTPSGRVFIMAALVTRMVPPVAIGIPLAS 157 Query: 133 GLAYFGLLNSVFGLALVYLTILAPFTTWLLKSGFDSIPREIESAAMIDG-ARLDQILRIL 191 ++ GL ++ L++ + TI P + WL+ S F+++P+++E AA +DG +RL + R++ Sbjct: 158 MMSAAGLADTPIALSIAHTTISLPLSIWLMSSFFEAVPQDLEEAATVDGCSRLGALWRVV 217 Query: 192 TLPLAAPVMATSALFAFLLAWDEFFYALLFTSDQRAKTLTVAIADLAGGRVSDYGLIATA 251 +P+ + +A +A+FAFL +W+EF +ALL T+ R++T V IA+ D+G + Sbjct: 218 -IPVVSGGIAVTAIFAFLASWNEFLFALLMTA-VRSQTTPVVIANFQTQFGLDWGSMTAL 275 Query: 252 GVLAALPPVLIGLIMQRALISGLTSGGVKG 281 + ++P +L+ L++QR +++G+T G VKG Sbjct: 276 AAVYSIPVILLTLLLQRKIVAGMTLGAVKG 305 Lambda K H 0.325 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 305 Length adjustment: 26 Effective length of query: 255 Effective length of database: 279 Effective search space: 71145 Effective search space used: 71145 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory