Align High-affinity branched-chain amino acid ABC transporter permease LivM (characterized, see rationale)
to candidate WP_058929662.1 AU252_RS04330 branched-chain amino acid ABC transporter permease
Query= uniprot:A0A159ZYE0 (418 letters) >NCBI__GCF_001484605.1:WP_058929662.1 Length = 322 Score = 153 bits (387), Expect = 6e-42 Identities = 95/304 (31%), Positives = 154/304 (50%), Gaps = 33/304 (10%) Query: 123 YVMLGLGLNIVVGLAGLLDLGYVGFYAVGAYSYALLSHYFGLSFWICLPIAGMMAATFGF 182 Y + LGL + G +GLL+ G GF AVGAY +A+ + FG+ F++ L IA + +A F Sbjct: 22 YALAALGLAVHFGYSGLLNFGQAGFMAVGAYGFAISTLTFGVPFFVGLVIAVICSAIFAM 81 Query: 183 LLGFPVLRLRGDYLAIVTLGFGEIIRLFL--RNLTDITGGPNGISNIEKPTFFGLTFERK 240 LLG P LRLR DYLAIVT+ EI+R + LT +TG NG++ E + F Sbjct: 82 LLGIPTLRLRADYLAIVTIAAAEIVRYIVTTNQLTAVTGSANGLAAFEGGFYAMNPFPAG 141 Query: 241 AAEGLQTFHEYFGLEYNSINKVIFLYLVALLLALAALFVINRLLRMPIGRAWEALREDEI 300 + G+ N+ F+ +V L + ++ L+R P GR + +REDE Sbjct: 142 SYMGMN-------------NRDFFIRVVGWGLVIICCTLVWLLMRSPWGRVLKGIREDEN 188 Query: 301 ACRALGLNPTVIKLSAFTLGAAFAGFAGSFFAARQGLVTPESFTFIESAIILAIVVLGGM 360 A R+LG N K+ A +G AG F +G V P ++ + + ++LGG+ Sbjct: 189 AVRSLGKNVYAYKMQALIMGGVLGALAGMIFTLPRGAVQPANYGTELTFFLYTCLLLGGL 248 Query: 361 GSQLGVILAAIVMILLPEMMR------------------EFSEYRMLMFGALMVLMMIWR 402 G+ LG ++ A++ ++ + + + + R ++ G ++L+MI+R Sbjct: 249 GTVLGPVIGAMIFWVVLSLTQGILYGLIESGAVTWLNTVQAGQLRYILVGVALMLLMIFR 308 Query: 403 PQGL 406 PQG+ Sbjct: 309 PQGV 312 Lambda K H 0.331 0.145 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 437 Number of extensions: 32 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 322 Length adjustment: 30 Effective length of query: 388 Effective length of database: 292 Effective search space: 113296 Effective search space used: 113296 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory