Align NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_058929073.1 AU252_RS00660 ABC transporter ATP-binding protein
Query= TCDB::Q7A2H0 (260 letters) >NCBI__GCF_001484605.1:WP_058929073.1 Length = 254 Score = 165 bits (418), Expect = 8e-46 Identities = 97/255 (38%), Positives = 141/255 (55%), Gaps = 5/255 (1%) Query: 6 SPPLPLLAASGLCKSFGGIKAVQEARIEVAQGSITGLIGPNGAGKTTLFNLLSNFIRPDK 65 +P P LA GL GG + +Q+ V G + G+IGPNGAGKTTLFNL+S +RP + Sbjct: 3 APVRPALAVDGLGLQIGGARILQDVSFAVGAGEMIGVIGPNGAGKTTLFNLISGVMRPTE 62 Query: 66 GRVIFDGEPIQQLQPHQIAQQGMVRTFQVARTLSRLSVLENMLLAAQKQTGENFWQVQLQ 125 G V +G I H+ A+ G+ RTFQ + RLSVLEN+ LAAQ + G +F ++ Sbjct: 63 GSVSLNGREITSAPVHRRAKAGLGRTFQTSNLFPRLSVLENVRLAAQAKIGGSFSILRFP 122 Query: 126 PQVVVKEEKQLQEQAMFLLESVGLAKKAYEYAGGLSGGQRKLLEMGRALMTNPKLILLDE 185 + A + VGL + AG LS G+++ +E+ L T+P ++LLDE Sbjct: 123 -----SASDEATRIARSTISEVGLTGQLTTAAGDLSHGEKRKVEIAVLLATDPAVVLLDE 177 Query: 186 PAAGVNPRLIDDICDRILTWNRQDGMTFLIIEHNMDVIMSLCDRVWVLAEGQNLADGTPA 245 P AGV + + I +R G T +++EH+MDV++ L DRV V+ G LA +P Sbjct: 178 PMAGVASGDVPSLTAIIRGMHRDRGCTVMMVEHHMDVVLGLVDRVAVMHHGSLLALDSPD 237 Query: 246 EIQTNSQVLEAYLGK 260 + + V AYLG+ Sbjct: 238 AVMADPIVQSAYLGE 252 Lambda K H 0.319 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 254 Length adjustment: 24 Effective length of query: 236 Effective length of database: 230 Effective search space: 54280 Effective search space used: 54280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory