Align isovaleryl-CoA dehydrogenase (EC 1.3.8.4) (characterized)
to candidate WP_058929104.1 AU252_RS00845 acyl-CoA dehydrogenase family protein
Query= BRENDA::P12007 (424 letters) >NCBI__GCF_001484605.1:WP_058929104.1 Length = 382 Score = 216 bits (551), Expect = 7e-61 Identities = 133/383 (34%), Positives = 199/383 (51%), Gaps = 6/383 (1%) Query: 43 LNEEQKQLRHTISKFVQENLAPKAQEIDQSNDFKNLREFWKQLGSLGVLGITAPVQYGGS 102 L E R TI+ FV++ + P E + F E +++LG LGV G+ QYGG Sbjct: 3 LTSEHHAFRSTIASFVEKEVQPYVDEWEAKGCFP-AHELFRKLGDLGVFGLAYDPQYGGD 61 Query: 103 GLGYLEHVLVMEEISRA-SAAVGLSYGAHSNLCINQIVRNGNEAQKEKYLPKLISGEFIG 161 G + ++ EE+ R SA V + G H + + G E K KYL + GE + Sbjct: 62 GADHSYLLIAAEELGRIRSAGVSMGIGVHMMMSTPSLHEFGTEELKRKYLVPALRGETVS 121 Query: 162 ALAMSEPNAGSDVVSMRLKAEKKGDHYVLNGNKFWITNGPDADVLVVYAKTDLTAVPASR 221 A+ ++EP+AGSDV +R KA GD +V+NG K +ITNG AD + + A+T T R Sbjct: 122 AIGVTEPDAGSDVAGLRTKATIDGDEWVINGLKTYITNGTQADWICLLART--TDEGGYR 179 Query: 222 GITAFIVEKDMPGFSTSKKLDKLGMRGSNTCELVFEDCKVPAANILSQESKGVYVLMSGL 281 G++ IV+ D PG S S+ L+KLG R S+T E+ FE+ +VP +N + + +G MS Sbjct: 180 GMSQIIVDMDTPGVSISRSLEKLGNRSSDTAEIKFENVRVPISNTIGEAGRGFQQQMSQF 239 Query: 282 DLERLVLAGGPLGIMQAVLDHTIPYLHVREAFGQKIGQFQLMQGKMADMYTRLMACRQYV 341 +ER+ G +Q LD T YL R FG+ + Q + +A++ RL R Y Sbjct: 240 VVERMFACYSRPGALQDALDRTAEYLQQRTVFGRPLAANQYISFTLAELSARLDVMRFYN 299 Query: 342 YNVARACDEGHITAKDCAGVILYTAECATQVALDGIQCLGGNGYINDFPMGRFLRDAKLY 401 +++ A + G T + L + ++A +Q GG GY+ + RFLRD +L Sbjct: 300 WSMVEAFEAGEDTTRMATIGKLLVGRLSREIADACLQFHGGLGYMEEHWTARFLRDHRLM 359 Query: 402 EIGGGTSEVRRLVIGR--AFNAD 422 IGGG EV V+ + F+AD Sbjct: 360 SIGGGADEVMLQVLSKMDGFSAD 382 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 375 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 424 Length of database: 382 Length adjustment: 31 Effective length of query: 393 Effective length of database: 351 Effective search space: 137943 Effective search space used: 137943 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory