Align acyl-CoA dehydrogenase subunit (EC 1.3.8.4; EC 1.3.8.5) (characterized)
to candidate WP_058929218.1 AU252_RS01515 acyl-CoA dehydrogenase family protein
Query= metacyc::MONOMER-11693 (386 letters) >NCBI__GCF_001484605.1:WP_058929218.1 Length = 398 Score = 505 bits (1300), Expect = e-147 Identities = 259/388 (66%), Positives = 305/388 (78%), Gaps = 6/388 (1%) Query: 1 MDHRLTPELEELRRTVEEFAHDVVAPKIGDFYERHEFPYEIVREMGRMGLFGLPFPEEYG 60 +D L+ E ++L +TV EFA +V+AP E H FPYE+V +M MGLFGLPFPEEYG Sbjct: 2 VDFELSEEHQDLIKTVREFADEVIAPVSAKHDEEHSFPYEVVSQMADMGLFGLPFPEEYG 61 Query: 61 GMGGDYLALGIALEELARVDSSVAITLEAGVSLGAMPIHLFGTDAQKAEWLPRLCSGEIL 120 GMGGDY AL +ALE+L RVD SVAITLEAGVSLGAMP++ FGT+AQK EWLP L SG+ L Sbjct: 62 GMGGDYFALALALEQLGRVDQSVAITLEAGVSLGAMPVYRFGTEAQKEEWLPLLASGKAL 121 Query: 121 GAFGLTEPDGGSDAGATRTTARLDESTNEWVINGTKCFITNSGTDITGLVTVTAVTGRKP 180 FGLTEP+ GSDAG T+T A +WVING K FITNSGTDIT LVTVTAVTGRK Sbjct: 122 AGFGLTEPEAGSDAGGTKTHAH--RQNGDWVINGNKEFITNSGTDITRLVTVTAVTGRKE 179 Query: 181 --DG--KPLISSIIVPSGTPGFTVAAPYSKVGWNASDTRELSFADVRVPAANLLGEQGRG 236 DG K IS+I+VP+ TPGF Y+KVGWNASDT L+ DVRVP ANLLG +GRG Sbjct: 180 RKDGSLKKEISTILVPTNTPGFKAEKAYNKVGWNASDTHPLTLKDVRVPEANLLGAEGRG 239 Query: 237 YAQFLRILDEGRIAISALATGLAQGCVDESVKYAGERHAFGRNIGAYQAIQFKIADMEMK 296 YA FL ILDEGRIAI+ALATG AQGCVD+SV+YA ER AFG+NIG YQAI FKIA M+ + Sbjct: 240 YANFLSILDEGRIAIAALATGAAQGCVDQSVRYARERSAFGQNIGKYQAIAFKIARMQAR 299 Query: 297 AHMARVGWRDAASRLVAGEPFKKEAAIAKLYSSTVAVDNAREATQIHGGYGFMNEYPVAR 356 AH AR+ + DAA+R++AG PFK +AAIAK+ + A+DNAR+ATQ+ GGYGF+NE+ VAR Sbjct: 300 AHTARLAYYDAAARMLAGRPFKTQAAIAKMVAGEAAMDNARDATQVFGGYGFINEFTVAR 359 Query: 357 MWRDSKILEIGEGTSEVQRMLIARELGL 384 +RDSKILE+GEGT+EVQ MLIARELGL Sbjct: 360 HYRDSKILEVGEGTTEVQLMLIARELGL 387 Lambda K H 0.318 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 544 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 398 Length adjustment: 31 Effective length of query: 355 Effective length of database: 367 Effective search space: 130285 Effective search space used: 130285 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory