Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 3/3) (EC 1.3.1.109) (characterized)
to candidate WP_058929091.1 AU252_RS01430 electron transfer flavoprotein subunit beta/FixA family protein
Query= BRENDA::D2RIQ2 (263 letters) >NCBI__GCF_001484605.1:WP_058929091.1 Length = 257 Score = 125 bits (313), Expect = 1e-33 Identities = 91/264 (34%), Positives = 141/264 (53%), Gaps = 10/264 (3%) Query: 1 MNIVVCVKQVPDTAE-MKIDPVTNNLVRDGVTNIMNPYDQYALETALQLKD-ELGAHVTV 58 M I+V VKQVPDT E ++D VT L RD ++ + ++ ALE AL+ KD G+ V V Sbjct: 1 MKIIVLVKQVPDTEEERRLDSVTGVLDRDASESVADEINERALEVALRHKDANKGSEVVV 60 Query: 59 ITMGPPHAESVLRDCLAVGADEAKLVSDRAFGGADTLATSAAMANTIKHFGVPDLILCGR 118 +TMGP A LR L++GAD A V D GAD T+A +A ++ G DL++ G Sbjct: 61 LTMGPASATQALRKALSMGADSAVHVEDDRLEGADIATTAAVLAAAVQRTGF-DLVVAGN 119 Query: 119 QAIDGDTAQVGPEIAEHLGLPQVTAALKVQVKDDTVVVDRDNEQMSMTFTMKMPCVVTVM 178 ++ DG V +AEHLGLP +++ +++ TV + E S+ + +P +V+V Sbjct: 120 ESTDGRGGVVPAMMAEHLGLPLLSSLNTLELTGGTVAGEVTVESGSLAVSAALPAIVSVT 179 Query: 179 -RSKDLRFASIRGKMKARKAEIPVYTAAALEIPLDIIGKAGSPTQVMKSFTPKVTQVHGE 237 RS + RF + +G M A++ P+ T + ++ LD G+ T + S P T + Sbjct: 180 ERSAEARFPNFKGIMTAKRK--PLATLSLTDLGLDAGVTGGTSTVLTISERPART-AGKK 236 Query: 238 IFDDEDPAVAVDKLVNKLIEDKII 261 I DD A +L L+ ++I Sbjct: 237 IVDD---GTAARELAEFLVAGRLI 257 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 121 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 257 Length adjustment: 24 Effective length of query: 239 Effective length of database: 233 Effective search space: 55687 Effective search space used: 55687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory