Align Histidine transport system permease protein HisM (characterized)
to candidate WP_083510396.1 AU252_RS13900 amino acid ABC transporter permease
Query= SwissProt::P0A2I7 (235 letters) >NCBI__GCF_001484605.1:WP_083510396.1 Length = 334 Score = 114 bits (285), Expect = 2e-30 Identities = 74/209 (35%), Positives = 111/209 (53%), Gaps = 11/209 (5%) Query: 20 FTGVAITLWLLISSVVMGGLLAVILAVGRVSSNKFIRFPIWLFTYIFRGTPLYVQLL--- 76 F GV TL L + ++++ +LAV+L+ R S N + + W + + FRGTP+Y QL+ Sbjct: 75 FKGVGWTLLLTVMAMIIAIVLAVLLSFMRQSDNPVLAWSSWFWVWFFRGTPVYTQLIFWG 134 Query: 77 ---VFYSGMYTLEIVKGTDLLNAFFRS---GLNCTVLALTLNTCAYTTEIFAGAIRSVPH 130 V Y + +L I G +LL+ G V+ L LN AY EIF ++SV Sbjct: 135 LITVLYPSI-SLGIPFGPELLHVVVSDPTKGFIPAVIGLGLNESAYLAEIFRAGLKSVDK 193 Query: 131 GEIEAARAYGFSSFKMYRCIILPSALRIALPAYSNEVILMLHSTALAFTATVP-DLLKIA 189 G+ EAA A G + K+ IILP A+R+ +P NE I ML +T+L DL + Sbjct: 194 GQTEAAEALGMARRKVMWRIILPQAMRVIVPPTGNETISMLKTTSLVLAVPFTLDLTFVT 253 Query: 190 RDINSATYQPFTAFGIAAVLYLLISYVLI 218 + + TYQP +AA YLL++ +L+ Sbjct: 254 NALANRTYQPIPLLIVAATWYLLVTSILM 282 Lambda K H 0.330 0.141 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 235 Length of database: 334 Length adjustment: 26 Effective length of query: 209 Effective length of database: 308 Effective search space: 64372 Effective search space used: 64372 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory