Align Histidine transport system permease protein HisM (characterized)
to candidate WP_240484359.1 AU252_RS09255 amino acid ABC transporter permease
Query= SwissProt::P0A2I7 (235 letters) >NCBI__GCF_001484605.1:WP_240484359.1 Length = 286 Score = 111 bits (278), Expect = 1e-29 Identities = 74/222 (33%), Positives = 117/222 (52%), Gaps = 9/222 (4%) Query: 16 DGYRFTGVAITLWLLISSVVMGGLLAVILAVGRVSSNKFIRFPIWLFTYIFRGTPLYVQL 75 D + GV +TL L + S+V+ LLA+++A R+S+N + WL+ ++FRGTPL VQ+ Sbjct: 31 DTHILAGVWLTLVLTVLSMVVSTLLAILIAAMRLSTNPVLSTLSWLYVWLFRGTPLLVQI 90 Query: 76 LVF-YSGMYTLEIVKGTDLLNAFFRS--------GLNCTVLALTLNTCAYTTEIFAGAIR 126 +++ Y G+ + G L + F S LALTLN AY++EI + Sbjct: 91 VLWGYLGLLYSRLSVGIPLTDMVFWSVDTNSLITAFVAGFLALTLNEAAYSSEIVRAGML 150 Query: 127 SVPHGEIEAARAYGFSSFKMYRCIILPSALRIALPAYSNEVILMLHSTALAFTATVPDLL 186 SV G+ EAA + G S + I+LP A+R+ +P NE+I ML +T+L V +L Sbjct: 151 SVDEGQREAAYSLGMSPLYTFSRILLPQAMRVIIPPMGNELISMLKNTSLLSVIAVLELY 210 Query: 187 KIARDINSATYQPFTAFGIAAVLYLLISYVLISLFRRAERRW 228 A I+S + + ++ YL ++ VL ERR+ Sbjct: 211 TQASLISSQNLKQVELLAVVSIWYLFMTSVLSVPQYYLERRF 252 Lambda K H 0.330 0.141 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 235 Length of database: 286 Length adjustment: 24 Effective length of query: 211 Effective length of database: 262 Effective search space: 55282 Effective search space used: 55282 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory