Align lysine-specific permease (characterized)
to candidate WP_058930272.1 AU252_RS08100 amino acid permease
Query= CharProtDB::CH_091040 (611 letters) >NCBI__GCF_001484605.1:WP_058930272.1 Length = 495 Score = 233 bits (593), Expect = 2e-65 Identities = 146/457 (31%), Positives = 238/457 (52%), Gaps = 22/457 (4%) Query: 106 VKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTIVYFVTQSLGEM 165 + R L RHI +ALG IGTGLF G ++ + AGP L+AYI G V+ V ++LGEM Sbjct: 27 LNRGLNVRHIRFMALGSAIGTGLFYGSASAIQKAGPA-VLLAYIIGGAAVFMVMRALGEM 85 Query: 166 ATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTDKVPLAA 225 A PV+ S ++ R+L P G G+ Y F AI +V+ + +W +V Sbjct: 86 AVRHPVSGSFGQYASRYLGPLAGFVTGWTYVFEMAIVAIADVTAFSIYMGFWFPQVDRWI 145 Query: 226 WIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYW 285 WI + +N VKV+GE EFW + +KV+AI+ ++ GG+ GF+ Sbjct: 146 WILAIICFLAALNLLSVKVFGELEFWFSLIKVVAIIAMIV-------GGAAIIAFGFQAA 198 Query: 286 RNPGAWGPG--IISSDKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAI 343 + A G G + F G ++S F + G E +GITAGEAA+P+K +P+A+ Sbjct: 199 GSTVAPGLGNLVEHGGLFPNGFEGLLASFAVVMFAFGGIETLGITAGEAADPKKVIPKAV 258 Query: 344 NKVVFRIVLFYIMSLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAV 403 N V R++LFY+++L + L P+N+ + SPFV G A P I NAV Sbjct: 259 NTVPVRVLLFYVLTLGVLMSLFPWNEIGSN-------GSPFVQIFSGLGIPAAPHILNAV 311 Query: 404 VLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALGLLAFLVV 463 V+ +SA NS+++ R+L+ L+ G+AP FG V+R GVP++ VV A + L+ ++ Sbjct: 312 VITAALSAINSDIFGAGRILFGLSGQGHAPAVFGKVSRHGVPWMTVVMMAGILLVGVVLN 371 Query: 464 NNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGISRDDLPFKAKLMPYGAYY 523 F + +I+T A + W+ I +H+ + + + + + P + P + Sbjct: 372 AVIPEDVFILIASIATFATVWVWVMILASHVAMKREIARKALPASEFP--SPWWPAASVL 429 Query: 524 AAFFVTVIIFIQGFQAFCPFKVSEFF-TSYISLILLA 559 F+ ++I + G AF +V+ + +++ L++LA Sbjct: 430 TIAFMALVIAVLG--AFEDTRVALYVGAAWLGLLVLA 464 Lambda K H 0.324 0.138 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 724 Number of extensions: 32 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 611 Length of database: 495 Length adjustment: 36 Effective length of query: 575 Effective length of database: 459 Effective search space: 263925 Effective search space used: 263925 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory