Align mannitol 2-dehydrogenase (NADP+) (EC 1.1.1.138) (characterized)
to candidate WP_058931176.1 AU252_RS13535 NAD(P)-dependent alcohol dehydrogenase
Query= BRENDA::Q1ACW3 (345 letters) >NCBI__GCF_001484605.1:WP_058931176.1 Length = 353 Score = 152 bits (384), Expect = 1e-41 Identities = 107/349 (30%), Positives = 169/349 (48%), Gaps = 24/349 (6%) Query: 3 LPATMKALRYDKPESYAVVEVPLPTLRDNDVLIKVKACGVCGTDLHIHE----GEFIAKF 58 LPATM+A + + +PLP + VL++V A GVCG+D+H +E G+++ Sbjct: 16 LPATMRASVLKRQGDMVMETLPLPQPDADQVLVQVAAVGVCGSDVHYYEHGRIGDYVVDH 75 Query: 59 PLIPGHETVGVVAAIGKDVKGFTVGERVCADNSELCNECFYCRRGQLLLCEKFEAHGV-T 117 PLI GHE G +AA+G V +G RV + C C C+ G+ LC E + Sbjct: 76 PLILGHELSGRIAAVGSAVDPARIGNRVAVEPQRPCRTCKQCKAGRYNLCPDIEFYATPP 135 Query: 118 MDGGFAEYCAYPAGKVFKI-HNLSDVDATLLEPASCAAHGLEKIAPKIGSSVLMFGAGPT 176 +DG FAEY + + I ++SD A L+EP S E+ K GS VL+ GAGP Sbjct: 136 IDGAFAEYVTIQSDFAYDIPDSVSDEAAALIEPLSVGLWACERAEIKPGSRVLIAGAGPI 195 Query: 177 GLCLAQLPHN-GASHVVIAAPEGLKMDLAKKLDCADIYVPLSRSNPQAQFDQIKSDNPYG 235 G+ AQ GA+ + I D A+ + + + K+D+ G Sbjct: 196 GIIAAQAARAFGATEIYIT-------------DIAEDRLAFALEHGATHALNAKTDSVEG 242 Query: 236 FDI--VVEATGSPKILEDAINYVRRGGKLVVYGVYSDAARVSWPPSKIFGDEITIIGSFS 293 D+ ++A+G+P+ + I V G++++ G+ +D V P S I EI + G F Sbjct: 243 LDVDAFIDASGAPQAVRSGIKAVGPAGRVILVGLGAD--DVELPVSYIQNREIWLSGVFR 300 Query: 294 ETYMFPATIGYLDTGKVKVEGIVNKTYKLEQWGECLEAMRNKSAIKAAI 342 T +P I + GKV ++ +V + L + E L+A + +KA + Sbjct: 301 YTNTWPLAIQLIADGKVDLDILVTGKFTLAESEEALKAGKQAGQLKAVV 349 Lambda K H 0.320 0.138 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 345 Length of database: 353 Length adjustment: 29 Effective length of query: 316 Effective length of database: 324 Effective search space: 102384 Effective search space used: 102384 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory