Align Fructokinase (EC 2.7.1.4) (characterized)
to candidate WP_058932854.1 AU252_RS09170 PfkB family carbohydrate kinase
Query= reanno::Dino:3609413 (308 letters) >NCBI__GCF_001484605.1:WP_058932854.1 Length = 312 Score = 155 bits (392), Expect = 1e-42 Identities = 117/315 (37%), Positives = 159/315 (50%), Gaps = 18/315 (5%) Query: 1 MILCAGEALIDMLPRALPDGTAGFAPVAGGAVFNTAVALGRLGADVGLVTGLSRDLFGEV 60 M+ GE L+D++ RA +G GG+ N AV L RL V V RD +G+ Sbjct: 1 MLTVIGEGLVDVVQRA-----SGIEAHVGGSPLNVAVGLARLDHPVQFVGRYGRDAYGDS 55 Query: 61 LMTALAAADVDSDMAVLSDRPTTLAFVTLTD-GHAQYAFYDENTAGRMLAPADMPDPGPE 119 + L ++ V + + PT++A + D G A Y F + A + +D + Sbjct: 56 VAAHLRSSSVMLPLGP-DELPTSVATAVIDDDGAATYTF---DLAWELPGLSDRLAFMLQ 111 Query: 120 VGTLFF-GGISLAVEPCAAAYEALCLKAAAGRVVMLDPNIRPGFIKDETTFRARIDRMLA 178 TL G I+ + P AAA A A + DPN RP I D R + ++ + Sbjct: 112 GTTLLHTGSIATMLAPGAAAVLAAVEHAHPAATISFDPNCRPSIITDVDYARRQAEKFVT 171 Query: 179 VTDIVKVSDEDLAWLMGPGDLAESAAALRA----RGPAVVCVTRGGAGVEAHTATGITHV 234 ++D+VK SDEDL WL D+ ESA + GPA+V VTRG AG TA G + Sbjct: 172 LSDVVKASDEDLEWLYPGVDVLESARRWLSLGGSEGPALVVVTRGAAGPWGITAAGEAAI 231 Query: 235 AAEAVEVVDTVGAGDTFNAGFLAGLAEA---GALDKDRLRALDAPVLTSALRLGAQAAAI 291 A VEV DTVGAGD+F A L+G+ + GA ++ LR L A L L A+AAA+ Sbjct: 232 DAPRVEVADTVGAGDSFMAALLSGIVDRGLDGAQNRKDLRELPAEGLAELLAHAARAAAV 291 Query: 292 TVSRAGANPPWRDEL 306 TVSR GANPP R EL Sbjct: 292 TVSRPGANPPTRAEL 306 Lambda K H 0.320 0.136 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 242 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 312 Length adjustment: 27 Effective length of query: 281 Effective length of database: 285 Effective search space: 80085 Effective search space used: 80085 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory