Align trans-2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_058930224.1 AU252_RS07800 enoyl-CoA hydratase
Query= reanno::BFirm:BPHYT_RS17335 (258 letters) >NCBI__GCF_001484605.1:WP_058930224.1 Length = 258 Score = 336 bits (862), Expect = 2e-97 Identities = 170/256 (66%), Positives = 202/256 (78%), Gaps = 1/256 (0%) Query: 3 YENILVETRGRVGLVTLNRPKALNALNDALMDELGAALREFDADDAIGAIVVTGSEKAFA 62 Y NILVE RGRVGLVTLNRP+ALNAL+ A MD+L AA+ DAD +GA+V+TGS KAFA Sbjct: 4 YTNILVEQRGRVGLVTLNRPEALNALDKATMDQLVAAVTAMDADPGVGAVVITGSSKAFA 63 Query: 63 AGADIGMMSTYTYMDVYKGDYITRNWETVRSIRKPIIAAVAGFALGGGCELAMMCDIIFA 122 AGADI M++ YMD+Y D+ R WE +R P+IAAV+GFALGGGCELAMMCD I A Sbjct: 64 AGADIKEMASQGYMDMYAADWF-RGWEDFTRLRIPVIAAVSGFALGGGCELAMMCDFIIA 122 Query: 123 ADTAKFGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERAGLVSRVIP 182 D AKFGQPEI LG++PG GG+QRL RAV KAKAMD+ LT RF+ A EAER+GLVSRV+P Sbjct: 123 GDNAKFGQPEINLGVLPGMGGSQRLTRAVGKAKAMDMILTGRFIGAEEAERSGLVSRVVP 182 Query: 183 AASLVDEAIAAAATIAEFPSPAVMMVKESVNRAYETTLAEGVHFERRLFHSLFATEDQKE 242 A ++V+EA+ AA IA P M+ KE+VN A+ET LA+GV FERR+FHSLFA+EDQKE Sbjct: 183 AENVVEEALKAAEVIASKSKPVAMLAKEAVNAAFETGLAQGVLFERRIFHSLFASEDQKE 242 Query: 243 GMAAFVEKRKPVFKHR 258 GMAAF EKR+P F HR Sbjct: 243 GMAAFTEKRQPEFTHR 258 Lambda K H 0.321 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 258 Length adjustment: 24 Effective length of query: 234 Effective length of database: 234 Effective search space: 54756 Effective search space used: 54756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory