Align 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) (characterized)
to candidate WP_058929014.1 AU252_RS00320 3-hydroxyacyl-CoA dehydrogenase family protein
Query= BRENDA::C4IEM5 (282 letters) >NCBI__GCF_001484605.1:WP_058929014.1 Length = 292 Score = 194 bits (494), Expect = 1e-54 Identities = 112/280 (40%), Positives = 161/280 (57%), Gaps = 3/280 (1%) Query: 3 KVFVLGAGTMGAGIVQAFAAKGCEVIVRDIKEEFVDRGIATITKSLSKLVAKEKITEADK 62 +V VLG G MGAGI AF G +V+V + E G + S +K + E+ + Sbjct: 13 RVGVLGGGRMGAGIAHAFLIIGADVVVVERDEASAQAGRERVKSSAAKSI--ERNPGGNL 70 Query: 63 EEILSRISGTTDMKLAADCDLVVEAAIENMKIKKEIFAELDGICKPETILASNTSSLSIT 122 +E++SR+S + D AD +LVVEA E+ +K ++ P T+LASNTSSLS++ Sbjct: 71 DEMVSRLSVSVDYAAFADRELVVEAVPEDWDLKVTALRRVEEQLTPGTVLASNTSSLSVS 130 Query: 123 EVASATKRADKVIGMHFFNPAPVMKLVEVIRGAATSQETFDAVKEMSESIGKTPVEVAEA 182 +A R +GMHFFNP P L+EV+ G T E + + +GKT V V +A Sbjct: 131 GLAEELARPQDFLGMHFFNPVPASTLIEVVIGKQTRPELVEQARSWVHGLGKTAVVVNDA 190 Query: 183 PGFVVNRILIPMINEATFILQEGVAKEEDIDAAMKLGANHPMGPLALGDLIGLDVCLAIM 242 PGF +R+ + + EA +++EGVA +DID AM LG HP GPL D++GLDV L I Sbjct: 191 PGFASSRLGVAIALEAMRMVEEGVASAKDIDNAMVLGYKHPTGPLRTTDIVGLDVRLGIA 250 Query: 243 DVLYNETGDTKYRASSLLRKYVRAGWLGRKTGKGFYDYSK 282 L+ G+ ++ +LR V G LGRKTGKGF+D+++ Sbjct: 251 TYLHETLGE-RFAPPQILRDKVARGELGRKTGKGFFDWTQ 289 Lambda K H 0.317 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 292 Length adjustment: 26 Effective length of query: 256 Effective length of database: 266 Effective search space: 68096 Effective search space used: 68096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory