Align 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) (characterized)
to candidate WP_058931412.1 AU252_RS15015 3-hydroxyacyl-CoA dehydrogenase family protein
Query= BRENDA::Q0KEY8 (284 letters) >NCBI__GCF_001484605.1:WP_058931412.1 Length = 286 Score = 194 bits (493), Expect = 2e-54 Identities = 103/280 (36%), Positives = 168/280 (60%), Gaps = 2/280 (0%) Query: 5 TVGIVGAGTMGNGIAQACAVVGLNVVMVDISDAAVQKGVATVASSLDRLIKKEKLTEADK 64 TVG++G G MG GIA A + G NV++V+ +A+ + V S+ + I++ T+ + Sbjct: 9 TVGVLGGGRMGAGIAHAFLINGANVLVVERDEASAEAARERVESAAAKSIERGA-TDGNL 67 Query: 65 ASALARIKGSTSYDDLKATDIVIEAATENYDLKVKILKQIDGIVGENVIIASNTSSISIT 124 ++R+ + YDD K +V+EA E++DLKV L+ I+ + ++ +ASNTSS+S+ Sbjct: 68 DEMVSRLAVTVDYDDFKDRQLVVEAVPEDWDLKVTSLRGIEERLADDAYLASNTSSLSVN 127 Query: 125 KLAAVTSRADRFIGMHFFNPVPVMALVELIRGLQTSDTTHAAVEALSKQLGKYPITVKNS 184 LA R F+G+HFFNPVP L+E++ G QTS A + + LGK + V ++ Sbjct: 128 GLARELKRPQNFLGLHFFNPVPASTLIEVVLGEQTSPGLAEAAKRWVEALGKTAVVVNDA 187 Query: 185 PGFVVNRILCPMINEAFCVLGEGLASPEEIDEGMKLGCNHPIGPLALADMIGLDTMLAVM 244 PGF +R+ + EA ++ EG+AS +ID M LG HP GPL D++GLD L + Sbjct: 188 PGFASSRLGVAIALEAMRMVEEGVASAADIDAAMVLGYKHPTGPLRTTDIVGLDVRLGIA 247 Query: 245 EVLYTEFADPKYRPAMLMREMVAAGYLGRKTGRGVYVYSK 284 E L++ + ++ P ++++ VA G LGRKTG+G + +++ Sbjct: 248 EYLHSTLGE-RFAPPQILKDKVARGELGRKTGKGFFDWAE 286 Lambda K H 0.319 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 284 Length of database: 286 Length adjustment: 26 Effective length of query: 258 Effective length of database: 260 Effective search space: 67080 Effective search space used: 67080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory