Align Peroxisomal multifunctional enzyme A; MFE-A; MFE-1; EC 1.1.1.35 (characterized)
to candidate WP_205630569.1 AU252_RS12475 SDR family oxidoreductase
Query= SwissProt::Q9NKW1 (441 letters) >NCBI__GCF_001484605.1:WP_205630569.1 Length = 315 Score = 178 bits (451), Expect = 2e-49 Identities = 114/309 (36%), Positives = 174/309 (56%), Gaps = 17/309 (5%) Query: 3 LNFKDKVVIVTGAGGGIGKVYALEFAKRGAKVVVNDLGGSHTGQGSSSKAADKVVEEIKA 62 L + +V IVTGAG G+G+ +AL A+RGAKVVVNDLGGS G+G+ + A+ VV+EI A Sbjct: 8 LRYDGRVAIVTGAGRGLGRAHALLLAERGAKVVVNDLGGSKEGEGNDAGPANDVVQEIIA 67 Query: 63 AGGTAVANYDSV--EDG-EKIVQTAMDSFGGVDILINNAGILRDVSFGKMTDGDWDLVYR 119 AGG AVA+ ++V EDG IV+TA+ FG +DI++NNAGI R +F + + + Sbjct: 68 AGGEAVADTNNVGSEDGCHSIVETAVKEFGRIDIVVNNAGISRWATFPEADADNLERTLD 127 Query: 120 VHAKGAYKLSRAAWNHMREKNFGRIIMTSSAAGLYGNFGQANYGSMKMALVGLSNTLAQE 179 VH +G + +RAAW +M E+ +GR+I T+S G+ G Y + K AL+G + +LA Sbjct: 128 VHLRGTWHTTRAAWPYMEEQGYGRVITTTS-TGMLGLADNLAYATAKGALIGFTRSLAVA 186 Query: 180 GKSKNIHCNTIAPIAASRLTESVMPPEI----------LEQMKPDYIVPLVLYLCHQDTT 229 K I N IAP A +R +ES P I ++ M ++ P+V YL H+ Sbjct: 187 AAPKGILVNCIAPNAVTRPSESATKPNIVTATAVDKARMQAMDTAHVSPMVAYLAHESCQ 246 Query: 230 ETGGVFEVGAGWVSKVRLQRSAG-VYMKD-LTP-EKIKDNWAQIESFDNPSYPTSASESV 286 G + G G ++ L + G V+ D + P E + ++W +I + P S + Sbjct: 247 VNGEILVAGGGRFARWFLGITPGWVHEGDGVAPLEAVVEHWDEINDDADYYIPASLHDWA 306 Query: 287 SGILAAVNS 295 S + +++ Sbjct: 307 SNFMGHLSA 315 Lambda K H 0.313 0.131 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 352 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 441 Length of database: 315 Length adjustment: 30 Effective length of query: 411 Effective length of database: 285 Effective search space: 117135 Effective search space used: 117135 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory