Align High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale)
to candidate WP_058929111.1 AU252_RS00890 ABC transporter ATP-binding protein
Query= uniprot:A0A159ZWL6 (233 letters) >NCBI__GCF_001484605.1:WP_058929111.1 Length = 247 Score = 152 bits (385), Expect = 4e-42 Identities = 84/220 (38%), Positives = 131/220 (59%), Gaps = 2/220 (0%) Query: 2 LQFENVSTFYGKIQALHSVNVEVRQGEIVTLIGANGAGKSTLLMTLCGSPQAHSGSIRYM 61 L + +S +YG+ A+ V+ V G V ++G NGAGK+TLL+ L G +GS + Sbjct: 11 LAVDRMSAYYGQAVAVRDVSFSVPVGASVGILGPNGAGKTTLLLALAGHLPI-TGSYSFN 69 Query: 62 GEELVGQDSSHIMRKSIAVVPEGRRVFARLTVEENL-AMGGFFTDKGDYQEQMDKVLHLF 120 G + S + R+ +A+VP+ V A +T+E NL A T + M +VL LF Sbjct: 70 GVKRRQHRPSTLRRRGVALVPQTHAVIAEMTIERNLRAAWSTGTKDTSFANAMGEVLELF 129 Query: 121 PRLKERFTQRGGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFDIIEQLR 180 P L+ R + G +SGG++QMLA+GR L+S+P++L+LDEP+ GL+P ++ ++ + + LR Sbjct: 130 PALRGRAAELAGNLSGGQRQMLAVGRGLISRPRVLMLDEPTAGLSPKLVNELVEALITLR 189 Query: 181 KDGVTVFLVEQNANQALKIADRAYVLENGRVVMQGTGEAL 220 G+TV LVEQN + A + DR +VL +G + G E L Sbjct: 190 GSGLTVLLVEQNFSAAQRACDRLHVLRDGTIRWSGAAEDL 229 Lambda K H 0.320 0.137 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 247 Length adjustment: 23 Effective length of query: 210 Effective length of database: 224 Effective search space: 47040 Effective search space used: 47040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory