Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate WP_058929182.1 AU252_RS01295 ABC transporter ATP-binding protein
Query= uniprot:D8J1T6 (255 letters) >NCBI__GCF_001484605.1:WP_058929182.1 Length = 260 Score = 155 bits (392), Expect = 8e-43 Identities = 86/247 (34%), Positives = 136/247 (55%), Gaps = 19/247 (7%) Query: 6 LKIRDVSKRFGGLQALNGVGITIERGQIYGLIGPNGAGKTTFFNVITGLYQPDTGTFELD 65 L+I +SK FGG+ A+ V +T+E+GQ+ G+IGPNGAGKT+ N I+G +P +G+ LD Sbjct: 15 LEIIGLSKSFGGVHAVRDVSLTLEKGQVLGVIGPNGAGKTSLVNTISGRQRPTSGSVLLD 74 Query: 66 GKPYSPSAPHEVAKAGIARTFQNIRLFGEMTVLENVMVGCHVRTKQNVFGAVFRHKAARE 125 G+ + + + + G+AR++Q +F E+TV EN+ F K A + Sbjct: 75 GREVAGKPAYTLNRRGLARSYQQANVFAEVTVQENI-----------ARAGEFAGKRAID 123 Query: 126 EEAAIREKSQKLLDFVGIGQFAKRTARHLSYGDQRRLEIARALATDPQLLALDEPAAGMN 185 + ++ G+ A L YG Q+ L + + T P +L LDEPAAG+ Sbjct: 124 VDEFVQS--------TGLDTVWSTRAGALPYGQQKILGLVMTIHTGPSILLLDEPAAGLE 175 Query: 186 ATEKLGLRELLVKIQAEGKTILLIEHDVKLMMGLCNRITVLDYGKPIAEGVPADVQKNPA 245 +E+ + L+ + G +L++EHD+ L+ LC I V+D G +AEG+ +V P Sbjct: 176 MSERFRIDHLVKETTKRGCAVLIVEHDMDLIRRLCPNILVMDSGAVLAEGITNEVLARPD 235 Query: 246 VIEAYLG 252 V+EAYLG Sbjct: 236 VLEAYLG 242 Lambda K H 0.320 0.138 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 260 Length adjustment: 24 Effective length of query: 231 Effective length of database: 236 Effective search space: 54516 Effective search space used: 54516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory