Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate WP_058929181.1 AU252_RS01290 ABC transporter ATP-binding protein
Query= uniprot:D8IUY7 (241 letters) >NCBI__GCF_001484605.1:WP_058929181.1 Length = 239 Score = 181 bits (458), Expect = 2e-50 Identities = 99/225 (44%), Positives = 145/225 (64%), Gaps = 7/225 (3%) Query: 5 ILKVQQLSVAYGGIQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRVEGHI 64 +L V+ L V YG I+AV G+ + V+ GE V L GANGAGK+TT+KAI G++PAS H+ Sbjct: 10 LLAVRDLVVNYGPIRAVSGVSIGVHRGETVVLCGANGAGKSTTIKAIMGSVPASSGSVHL 69 Query: 65 EYLGQPLKGKKSFELVKDKLAMVPEGRGVFTRMSIQENLLMGAYT--SDDKGQIAADIDK 122 + GQP+ + + + + PEGR VF M+++EN+ +GA+ + D+ +++ Sbjct: 70 D--GQPITTVSAALRARRGIRLSPEGRQVFATMTVEENIRIGAHQLKATDRN---TRVEE 124 Query: 123 WFAVFPRLKERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPSMGLSPIMVEKIFEV 182 F FP L ER AG LSGG+QQ++AM RA+ S P+LLLLDEP +GL+PI + + + Sbjct: 125 LFDTFPLLAERRRSRAGDLSGGQQQIVAMGRAMASRPRLLLLDEPFLGLAPIWIASVSDA 184 Query: 183 IRNVSAQGITILLVEQNAKLALEAAHRGYVMESGLITMQGQAQQM 227 IR V A G +L+ EQ A+ ALE A RGYV++ G I +G A ++ Sbjct: 185 IRTVQAAGTALLISEQMARPALELADRGYVLKHGSIARRGTADEV 229 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 130 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 239 Length adjustment: 23 Effective length of query: 218 Effective length of database: 216 Effective search space: 47088 Effective search space used: 47088 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory