Align acyl-CoA oxidase (EC 1.3.3.6) (characterized)
to candidate WP_058929536.1 AU252_RS03530 acyl-CoA dehydrogenase family protein
Query= BRENDA::Q96329 (436 letters) >NCBI__GCF_001484605.1:WP_058929536.1 Length = 396 Score = 330 bits (845), Expect = 6e-95 Identities = 173/390 (44%), Positives = 243/390 (62%), Gaps = 5/390 (1%) Query: 39 STFPPCTSDYYHFNDLLTPEEQAIRKKVRECMEKEVAPIMTEYWEKAEFPFHITPKLGAM 98 + P D++ F LLT +EQ ++R + +EV PI + W + EFP + PKL + Sbjct: 9 NNLPYADGDFFAFEQLLTAKEQDRLAEIRGFLAREVRPIAVDCWNRGEFPMELIPKLAEI 68 Query: 99 GVAGGSIKGYGCPGLSITANAIATAEIARVDASCSTFILVHSSLGMLTIALCGSEAQKEK 158 + + G S + AE R D S +TF+ VH L +I S+ Q++ Sbjct: 69 DLVSPVRR----QGYSNLFAGLVHAEATRADTSIATFMGVHDGLFAGSIEALASQEQQDA 124 Query: 159 YLPSLAQLNTVACWALTEPDNGSD-ASGLGTTATKVEGGWKINGQKRWIGNSTFADLLII 217 +LP + L + + LTEP GSD A G TTA + W +NG KRWIGN+TF+D +++ Sbjct: 125 WLPDIYSLKKIGAFGLTEPLGGSDVAGGTRTTAQRNGDTWILNGAKRWIGNATFSDWVVV 184 Query: 218 FARNTTTNQINGFIVKKDAPGLKATKIPNKIGLRMVQNGDILLQNVFVPDEDRLPGVNSF 277 +AR+ NQ+ GF+V PG ATKI NKI LR VQN DI+L+NV VPD +L G NSF Sbjct: 185 YARDLADNQVKGFLVDTALPGFSATKIENKISLRTVQNADIVLENVVVPDFFKLAGANSF 244 Query: 278 QDTSKVLAVSRVMVAWQPIGISMGIYDMCHRYLKERKQFGAPLAAFQLNQQKLVQMLGNV 337 +DT+KVL V+R+ V WQ +G + +D+ RY ER QFG PLA+FQL Q +LVQ+LGN Sbjct: 245 RDTNKVLKVTRLSVGWQAVGQQLAAFDVARRYAVERHQFGRPLASFQLVQSQLVQILGNA 304 Query: 338 QAMFLMGWRLCKLYETGQMTPGQASLGKAWISSKARETASLGRELLGGNGILADFLVAKA 397 + M RL +L + GQ Q++L KA+ +++ RE+ ++GR LLGGNGI+ DF +AK Sbjct: 305 VSSMGMMVRLSQLEDAGQAKDEQSALAKAFTTARMRESVAIGRSLLGGNGIVTDFEMAKI 364 Query: 398 FCDLEPIYTYEGTYDINTLVTGREVTGIAS 427 F D E IY+YEGT++INTLVTGR +TGI++ Sbjct: 365 FADAEAIYSYEGTHEINTLVTGRAITGISA 394 Lambda K H 0.319 0.133 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 396 Length adjustment: 31 Effective length of query: 405 Effective length of database: 365 Effective search space: 147825 Effective search space used: 147825 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory