Align L-2,4-diketo-3-deoxyrhamnonate hydrolase; 2,4-dioxopentanoate hydrolase (characterized)
to candidate WP_058931156.1 AU252_RS13410 fumarylacetoacetate hydrolase family protein
Query= reanno::Smeli:SM_b21112 (281 letters) >NCBI__GCF_001484605.1:WP_058931156.1 Length = 280 Score = 218 bits (555), Expect = 1e-61 Identities = 128/279 (45%), Positives = 170/279 (60%), Gaps = 9/279 (3%) Query: 1 MKLLRYGEPGQEKPGLLGSDG--IIRDLSGHVSDLAAGALDPSKLDELANLDVETLPAVS 58 MK + G PG E+P L+ D ++ ++ ++ P+ A L TLP VS Sbjct: 1 MKFAQIGAPGAEQPVLVHGDRHYSLQSITPAINGDFLSNGGPAAA--AAALAAGTLPDVS 58 Query: 59 GNP-RLGPCVAGTGKFICIGLNYSDHAAETGATVPPEPIIFMKATSAIVGPNDDLVLPRG 117 + R G V +C+GLNY+ HAAE+GA P P+IF+K + + GP+D + +PRG Sbjct: 59 SDAVRYGAPVVRPSAVVCVGLNYAAHAAESGAEPPEHPVIFLKTPNTVGGPDDAVAIPRG 118 Query: 118 SEKTDWEVELGIVIGKTAKYVSEAEAL-DYVAGYCTVHDVSERAFQTE-RHGQWTKGKSC 175 S KTDWEVELGI+IGK A Y+ EA D++ G+ V D+SER FQ GQW+KGKS Sbjct: 119 STKTDWEVELGIIIGKRASYLDSPEAARDHIGGFVVVDDLSERDFQLNVSGGQWSKGKSS 178 Query: 176 DTFGPTGPWLVTKDEVADPQDLAMWLKVNGETMQDGSTKTMVYGAAHLVSYLSQFMSLRP 235 F PTGP+LVT DE+ D L + VNGE QD ST M++ +V LSQ+M L P Sbjct: 179 PGFCPTGPYLVTPDEI-DAGKLRLRSWVNGEIRQDSSTADMIFDVETIVWNLSQYMVLEP 237 Query: 236 GDIISTGTPPGVGMGMKPPRYLKAGDVVELGIEGLGSQK 274 GD+I TGTP GV + + P YLKAGDVVE+ I+GLG Q+ Sbjct: 238 GDLICTGTPEGVALSGRFP-YLKAGDVVEIEIDGLGRQR 275 Lambda K H 0.315 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 311 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 280 Length adjustment: 26 Effective length of query: 255 Effective length of database: 254 Effective search space: 64770 Effective search space used: 64770 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory