Align SmoF, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate WP_058931174.1 AU252_RS13525 sugar ABC transporter permease
Query= TCDB::O30832 (290 letters) >NCBI__GCF_001484605.1:WP_058931174.1 Length = 322 Score = 202 bits (514), Expect = 8e-57 Identities = 116/283 (40%), Positives = 165/283 (58%), Gaps = 9/283 (3%) Query: 9 AARLMISPAVILLFLWMIVPLSMTLYFSFLRYNLLMPGMESFTGWDNYYYFLTDPAFSAA 68 A R + PA+I L L +P +TL SFL +N L P +F G +NY LTDP A Sbjct: 32 ARRAPLLPALIFLILVTQLPFVVTLIISFLNWNSLSPDKTAFAGLENYVTVLTDPDLRQA 91 Query: 69 LTNTILLVVGVLLITVVGGVLLALLLDQPFWGQGIVRVLVIAPFFVMPTVSALVWKNMFM 128 + TILL V V+L ++V G+ LALLLD+ F G+G+ R L+IAPF V+P +AL+WK+ + Sbjct: 92 IFTTILLTVSVVLASLVIGLGLALLLDKKFIGRGLARTLLIAPFLVVPVAAALIWKHALL 151 Query: 129 NP----VNGMFAHIARGLG---LPPFDFLSQAPLASIIGIVAWQWLPFATLILLTALQSL 181 NP +NG+ I G P D LSQAP+ ++I + WQW PF LILL LQS Sbjct: 152 NPTYGLINGILTWIWSLFGSSTAPQLDLLSQAPMMAVIVSLVWQWTPFMMLILLAGLQSR 211 Query: 182 DREQMEAAEMDGASALDRFIHITVPHLTRAITVVVLIQTIFLLGVFAEILVTTNGGPGTA 241 + +EAA+MDGA+ F H+T+PHL + + + L+ I+++ F + T GG GTA Sbjct: 212 PMDTVEAAQMDGATPWAIFRHLTLPHLRQYLELGGLLGAIYIVQNFDAVFTLTAGGLGTA 271 Query: 242 STNITYLVYAQSLLNYDVGGGSAGGIVAVVLANIVAIFLMRMI 284 N+ Y +Y + G SA G+V V+ +VA F +R + Sbjct: 272 --NLPYAIYQTFYFANEYGLASAAGVVVVIGTIVVATFALRTV 312 Lambda K H 0.329 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 322 Length adjustment: 27 Effective length of query: 263 Effective length of database: 295 Effective search space: 77585 Effective search space used: 77585 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory