Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate WP_058930800.1 AU252_RS11300 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF1302 (334 letters) >NCBI__GCF_001484605.1:WP_058930800.1 Length = 373 Score = 226 bits (576), Expect = 7e-64 Identities = 112/238 (47%), Positives = 159/238 (66%) Query: 2 GQIKLESVTKNFGPVEVIPPLDLTIEDGEFTVFVGPSGCGKSTLLRLIAGLEDITSGTIR 61 G I+L V K +G V + LDL +E GEF +GPSG GK+T + ++AG E+ TSG++ Sbjct: 20 GSIELRQVRKTYGDVVAVDELDLVVEPGEFVTLLGPSGSGKTTTMMMVAGFEEHTSGSVL 79 Query: 62 IDGEDATNIPPAKRGLAMVFQSYALYPHMSVRKNIAFPMKMAGIPADEQKRRIDNAAAAL 121 IDG+ ++PP R L +VFQ+YAL+PHMS R+N+ F ++M IP E+++R D+A + Sbjct: 80 IDGKPVDSLPPRDRNLGVVFQNYALFPHMSARENVEFALRMRKIPKAERRQRADSALERV 139 Query: 122 NLTDYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVGMRLEISELHK 181 L DR+P QLSGGQ+QRVA+ R++V PAA L DEP++ LD LR M+ EI L K Sbjct: 140 GLGKMGDRKPRQLSGGQQQRVALARSLVFNPAALLLDEPMAALDKRLREHMQEEIKTLQK 199 Query: 182 RLATTMIYVTHDQVEAMTMADKIVVLQAGVIEQVGSPMELYRAPRNVFVAGFIGSPKM 239 L ++++VTHDQ EAM M+D+IVV++ G I Q G P E+Y P +VA F+G + Sbjct: 200 SLGISVLFVTHDQDEAMAMSDRIVVMKDGRIVQSGPPEEVYNHPLTDWVASFLGDTNL 257 Lambda K H 0.320 0.138 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 300 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 373 Length adjustment: 29 Effective length of query: 305 Effective length of database: 344 Effective search space: 104920 Effective search space used: 104920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory