Align Fructokinase; EC 2.7.1.4 (characterized)
to candidate WP_240484210.1 AU252_RS16245 sugar kinase
Query= SwissProt::P26420 (307 letters) >NCBI__GCF_001484605.1:WP_240484210.1 Length = 316 Score = 115 bits (287), Expect = 2e-30 Identities = 90/280 (32%), Positives = 136/280 (48%), Gaps = 13/280 (4%) Query: 28 GGAPANVAVGVARLGGDSGFIGRVGDDPFGRFMRHTLAQEQVDVNYMRLDAAQRTSTVVV 87 GG+ +N A+ + RLG ++GRVG+D G + LA E + V+ +R D + T ++ Sbjct: 35 GGSESNFAIALRRLGTSVTWVGRVGNDSLGELVLRELAAEGIVVDPLR-DESAPTGLMIK 93 Query: 88 DLDSHGERTFTFMVRPSADLFLQPEDLPP--FAAGQWLHVCSI--ALSAEPSRSTTFAAL 143 + + + + SA L ED+P + + LH+ I ALS E +R+ +A L Sbjct: 94 ERRTMDQLKVWYYRAGSAGSRLSREDIPAERISNARLLHLTGITPALSPEAARAAQYA-L 152 Query: 144 EAIKRAGGYVSFDPNIRSDLWQDPQDLRDCLDRALALADAIKLSEEELAFISGSDDIVSG 203 + + AG +VSFD N R+ LW D RD +A AD + ++E A G D Sbjct: 153 DVAREAGVHVSFDLNYRAALWS-ADDARDVFRNIIAQADIVFAGDDEAAIAVGKSDDSLE 211 Query: 204 IARLNARFQPTLLLVTQGKAGVQAALRGQVSHFPARPVVAVDTTGAGDAFVAGLLAGLAA 263 +AR A P ++ +G AG A + G A V A+DT GAGDAFVAG ++ L A Sbjct: 212 LARRVAALGPGQAVIKRGAAGCAAVIDGVEYVQDAVRVNAIDTVGAGDAFVAGYISDLLA 271 Query: 264 HGIPDNLAALAPDLALAQTCGALATTAKGAMTALPYKDDL 303 A++ L A GA A G +P + +L Sbjct: 272 G------ASVQERLLTAVRTGAFACLVPGDWEGMPRRHEL 305 Lambda K H 0.321 0.137 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 316 Length adjustment: 27 Effective length of query: 280 Effective length of database: 289 Effective search space: 80920 Effective search space used: 80920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory