Align sorbitol-6-phosphate dehydrogenase (characterized)
to candidate WP_058930590.1 AU252_RS10045 SDR family oxidoreductase
Query= CharProtDB::CH_091826 (259 letters) >NCBI__GCF_001484605.1:WP_058930590.1 Length = 311 Score = 110 bits (274), Expect = 5e-29 Identities = 83/259 (32%), Positives = 133/259 (51%), Gaps = 14/259 (5%) Query: 3 QVAVVIGGGQTLGAFLCEGLAQAGYHVAVADLNESNANRLADTINSRYGAGRAYGFKVDA 62 +VA+V G G+ LG LA+ G V + D++ A TI S G A V + Sbjct: 6 KVAIVTGSGRGLGLAYARELARQGAAVVINDVDADVAADAVRTIESDGGRAVAVVAPVGS 65 Query: 63 TDEASVEALARAVDETFGRADLLVYSAGVAKAAPITQFRLTDFDLSLQVNLVGYFLCSRE 122 T+ A + L + +TFGR D+LV +AG+ + + + DFDL + V+L G F C+RE Sbjct: 66 TEVA--KQLVQEAVQTFGRLDILVTNAGILRDRSLLKMTDEDFDLVINVHLKGTFTCARE 123 Query: 123 FSKLMIRDGIKGRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDLAEYGITVHSL 182 +GI GRII I S +G+ G+ + Y+AAK G VG+ ++ AL++ + G+TV+++ Sbjct: 124 AFGYFKENGIAGRIITIGSPTGQRGNFGQTNYAAAKAGIVGMVRTWALEMKKAGVTVNTV 183 Query: 183 M----LGNLLKSPMFQSLLPQYAEKLGITPEEVEPYYVDKVPLKRGCDYQDVLNVLLFYA 238 + P FQ + A++ G E + ++ ++ DV ++ F A Sbjct: 184 IPVAATAMTKTVPYFQKAVE--ADERG---EAMPAFFRHELGFGTA---DDVAGLIAFLA 235 Query: 239 SDKAAYCTGQSINVTGGQV 257 SD AA TGQ I G ++ Sbjct: 236 SDAAAGITGQVIGAGGDRL 254 Lambda K H 0.319 0.136 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 311 Length adjustment: 26 Effective length of query: 233 Effective length of database: 285 Effective search space: 66405 Effective search space used: 66405 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory