Align Fructokinase (EC 2.7.1.4) (characterized)
to candidate WP_058930348.1 AU252_RS08575 carbohydrate kinase
Query= reanno::Dino:3609413 (308 letters) >NCBI__GCF_001484605.1:WP_058930348.1 Length = 330 Score = 144 bits (362), Expect = 4e-39 Identities = 110/308 (35%), Positives = 153/308 (49%), Gaps = 23/308 (7%) Query: 2 ILCAGEALIDMLPRALPDGTAGFAPVAGGAVFNTAVALGRLGADVGLVTGLSRDLFGEVL 61 ++ GEAL+D++ A P+G GG+ N A LGRLG L+T L D GE + Sbjct: 17 VMVVGEALVDVV--ASPNGPIEHP---GGSPMNVAYGLGRLGVSTALLTSLGADARGEAI 71 Query: 62 MTALAAADVDSDMAVLSDRPTTLAFVTLT-DGHAQYAFYDENTAGRMLAPADMPDPGPEV 120 L +A V+ S T A TL DG A Y F D + AP+ +P Sbjct: 72 EAHLRSAGVELLPGSKSAARTASATATLAADGSASYDF-DISWELPAAAPSHLPK----- 125 Query: 121 GTLFFGGISLAVEPCAAAYEALCLKAAAGRVVMLDPNIRPGFIKDETTFRARIDRMLAVT 180 L G I+ + P A A AL ++ +V DPNIRP + + + ++ +T Sbjct: 126 -VLHTGSIATFLAPGATAVRALLEQSHRECLVTYDPNIRPALLGSQAEAVRIFEDLVPLT 184 Query: 181 DIVKVSDEDLAWLMGPGDLAESAAALRARGPAVVCVTRGGAGVEAHTATGITHVAAEAVE 240 D+VK+SDED AWL L ++A + G + VTRGG G + AT +T + A+ Sbjct: 185 DVVKLSDEDAAWLYPGVRLEDAAERILRLGAGLAVVTRGGEG--SLLATPVTQLFIPAIR 242 Query: 241 --VVDTVGAGDTFNAGFLAGLAEAGALDKDRLRALDAPVLTSALRLGAQAAAITVSRAGA 298 V DT+GAGD++ A + GL R L VLT+ R+ ++AAAITV R GA Sbjct: 243 STVADTIGAGDSYMAALIFGLLSR------RTEGLGQDVLTTIGRMASKAAAITVRRPGA 296 Query: 299 NPPWRDEL 306 NPP DEL Sbjct: 297 NPPTADEL 304 Lambda K H 0.320 0.136 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 330 Length adjustment: 28 Effective length of query: 280 Effective length of database: 302 Effective search space: 84560 Effective search space used: 84560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory