Align L-threonine 3-dehydrogenase (EC 1.1.1.103) (characterized)
to candidate WP_058931176.1 AU252_RS13535 NAD(P)-dependent alcohol dehydrogenase
Query= BRENDA::P07913 (341 letters) >NCBI__GCF_001484605.1:WP_058931176.1 Length = 353 Score = 169 bits (427), Expect = 1e-46 Identities = 104/340 (30%), Positives = 180/340 (52%), Gaps = 20/340 (5%) Query: 5 SKLKAEEGIWMTDVPVPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKTIPVPMVVGHE 64 S LK + + M +P+P+ + +L+++ +CG+DVH Y + P+++GHE Sbjct: 23 SVLKRQGDMVMETLPLPQPDADQVLVQVAAVGVCGSDVHYYEHGRIGDYVVDHPLILGHE 82 Query: 65 YVGEVVGIGQEVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRP--GCFA 122 G + +G V +IG+RV+ E C C+ C+ GR +LC + I P G FA Sbjct: 83 LSGRIAAVGSAVDPARIGNRVAVEPQRPCRTCKQCKAGRYNLCPD-IEFYATPPIDGAFA 141 Query: 123 EYLVIPAFNAFKIPDNISDDLAAIFDPFGNAVHTALSFDL-VGEDVLVSGAGPIGIMAAA 181 EY+ I + A+ IPD++SD+ AA+ +P + ++ G VL++GAGPIGI+AA Sbjct: 142 EYVTIQSDFAYDIPDSVSDEAAALIEPLSVGLWACERAEIKPGSRVLIAGAGPIGIIAAQ 201 Query: 182 VAKHVGARNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELGMTEGFDVG--LEM 239 A+ GA + ITD+ E RL A + G T A+N A+ EG DV ++ Sbjct: 202 AARAFGATEIYITDIAEDRLAFALEHGATHALN----------AKTDSVEGLDVDAFIDA 251 Query: 240 SGAPPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWTKVIFKGLFIKGIYGREMFETWYKMA 299 SGAP A R+ + + GR+ ++G+ D+ + + + + +++ G++ TW Sbjct: 252 SGAPQAVRSGIKAVGPAGRVILVGLGADDVELPVSYIQNREIWLSGVF--RYTNTWPLAI 309 Query: 300 ALIQSG-LDLSPIITHRFSIDDFQKGFDA-MRSGQSGKVI 337 LI G +DL ++T +F++ + ++ A ++GQ V+ Sbjct: 310 QLIADGKVDLDILVTGKFTLAESEEALKAGKQAGQLKAVV 349 Lambda K H 0.322 0.140 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 353 Length adjustment: 29 Effective length of query: 312 Effective length of database: 324 Effective search space: 101088 Effective search space used: 101088 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory