Align Acetaldehyde dehydrogenase; Acetaldehyde dehydrogenase [acetylating]; EC 1.2.1.10 (characterized)
to candidate WP_058931780.1 AU252_RS17310 acetaldehyde dehydrogenase (acetylating)
Query= SwissProt::Q9KWS1 (316 letters) >NCBI__GCF_001484605.1:WP_058931780.1 Length = 310 Score = 368 bits (945), Expect = e-107 Identities = 190/310 (61%), Positives = 238/310 (76%), Gaps = 10/310 (3%) Query: 6 LSVAIIGSGNIGTDLMIKIMRNSKLLKVGAMVGIDPKSDGLARAQRLGVPTTAEGVDGLL 65 + VAIIGSGNIGTDLM KIMR S+ L++GAMVGIDP SDGL RA +GVP T++GV GL+ Sbjct: 3 IKVAIIGSGNIGTDLMFKIMRRSRTLEMGAMVGIDPASDGLRRAASMGVPITSDGVQGLI 62 Query: 66 DMPAFRDIKIAFDATSAGAQAIHNQKLQAHGVRVIDLTPAAIGPYVIPVVNFDQHVDAPN 125 +MP F +I++ FDATSAG + L R++DLTPAA+GP+VIP VN ++H+DAP+ Sbjct: 63 EMPGFDEIEVVFDATSAGGHIANAAALAPFNKRLVDLTPAALGPFVIPAVNLEEHLDAPD 122 Query: 126 INMVTCGGQATIPIVHAVSKVSPVHYAEIVASISSKSAGPGTRANIDEFTETTSKAILEV 185 INMVTCGGQATIPIV AVS+V PV YAEIVAS++S+SAGPGTRANIDEFTETT+ AI +V Sbjct: 123 INMVTCGGQATIPIVAAVSRVVPVPYAEIVASVASRSAGPGTRANIDEFTETTAHAIEQV 182 Query: 186 GGAAQGRAIIILNPAEPPLIMRDTVYCFVSAEANIDAITDSVEQMVKSVQEYVPGYRLKQ 245 GGAA+G+AIIILNPA+PP IMRDTVYC ++ E + + I S+ +MV +V +YVPGYRLKQ Sbjct: 183 GGAARGKAIIILNPADPPPIMRDTVYC-LTGEVDHEKIRASITEMVAAVSQYVPGYRLKQ 241 Query: 246 KVQF-----EKIVAGNEQNIPGLGWSTGLKVSVFLEVEGAGHYLPSYAGNLDIMTSAGLT 300 VQ E + + ++ G+ W K++ FLEVEGA YLP+YAGNLDIMTSA L Sbjct: 242 DVQITPVEPETLASLLGKDAAGIRW----KITTFLEVEGAADYLPAYAGNLDIMTSAALR 297 Query: 301 VAERIAGSGV 310 V E +A + Sbjct: 298 VGELVAARDI 307 Lambda K H 0.317 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 363 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 310 Length adjustment: 27 Effective length of query: 289 Effective length of database: 283 Effective search space: 81787 Effective search space used: 81787 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate WP_058931780.1 AU252_RS17310 (acetaldehyde dehydrogenase (acetylating))
to HMM TIGR03215 (acetaldehyde dehydrogenase (acetylating) (EC 1.2.1.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03215.hmm # target sequence database: /tmp/gapView.3147836.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03215 [M=285] Accession: TIGR03215 Description: ac_ald_DH_ac: acetaldehyde dehydrogenase (acetylating) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-141 455.6 2.9 3.9e-141 455.4 2.9 1.0 1 NCBI__GCF_001484605.1:WP_058931780.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_001484605.1:WP_058931780.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 455.4 2.9 3.9e-141 3.9e-141 2 282 .. 3 305 .. 2 308 .. 0.98 Alignments for each domain: == domain 1 score: 455.4 bits; conditional E-value: 3.9e-141 TIGR03215 2 vkvaiiGsGnigtdllikllr.sevlelallvGidpesdGlararelgvetsaeGvdalleee...didivfd 70 +kvaiiGsGnigtdl++k++r s++le+ ++vGidp+sdGl+ra+++gv ++++Gv++l+e++ +i++vfd NCBI__GCF_001484605.1:WP_058931780.1 3 IKVAIIGSGNIGTDLMFKIMRrSRTLEMGAMVGIDPASDGLRRAASMGVPITSDGVQGLIEMPgfdEIEVVFD 75 79******************99****************************************99999****** PP TIGR03215 71 atsakahaenaklleelgkividltPaavGpyvvPavnleevldaknvnlvtCgGqatiPivaavsrvakvky 143 atsa h +na++l+ +k+++dltPaa+Gp+v+Pavnlee+lda+++n+vtCgGqatiPivaavsrv++v y NCBI__GCF_001484605.1:WP_058931780.1 76 ATSAGGHIANAAALAPFNKRLVDLTPAALGPFVIPAVNLEEHLDAPDINMVTCGGQATIPIVAAVSRVVPVPY 148 ************************************************************************* PP TIGR03215 144 aeivasiasksaGpgtranideftettskaleqvgGakkgkaiiilnPaePpllmrdtvyalveeadeeaiea 216 aeivas+as+saGpgtranideftett++a+eqvgGa++gkaiiilnPa+Pp +mrdtvy+l+ e+d+e+i+a NCBI__GCF_001484605.1:WP_058931780.1 149 AEIVASVASRSAGPGTRANIDEFTETTAHAIEQVGGAARGKAIIILNPADPPPIMRDTVYCLTGEVDHEKIRA 221 ************************************************************************* PP TIGR03215 217 sveemveevqkyvpGyrlkqevvld..................gekvsvlleveGagdylPkyaGnldiltaa 271 s++emv++v +yvpGyrlkq+v+++ k++++leveGa+dylP+yaGnldi+t+a NCBI__GCF_001484605.1:WP_058931780.1 222 SITEMVAAVSQYVPGYRLKQDVQITpvepetlasllgkdaagiRWKITTFLEVEGAADYLPAYAGNLDIMTSA 294 *****************************************87778*************************** PP TIGR03215 272 alavaeklaee 282 al+v+e +a++ NCBI__GCF_001484605.1:WP_058931780.1 295 ALRVGELVAAR 305 ******99986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (285 nodes) Target sequences: 1 (310 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 18.01 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory