Align deoxyribose-phosphate aldolase (EC 4.1.2.4) (characterized)
to candidate WP_058929608.1 AU252_RS03965 deoxyribose-phosphate aldolase
Query= BRENDA::C7E719 (220 letters) >NCBI__GCF_001484605.1:WP_058929608.1 Length = 241 Score = 265 bits (676), Expect = 7e-76 Identities = 134/221 (60%), Positives = 172/221 (77%), Gaps = 2/221 (0%) Query: 2 NIAALIDHTLLRADATKDEITKLTAEAKKYQFASVCVNPAWVAYAAEQLAGTGVATCTVI 61 NIA+ IDHTLL+ +A++ EI K+ AEA +Y F SVCVNP WV L +GV TC+VI Sbjct: 21 NIASYIDHTLLKPEASEAEILKVCAEAAEYHFKSVCVNPLWVKTVKTALKRSGVLTCSVI 80 Query: 62 GFPLGANTSATKAFETKDAIANGATEVDMVINIGALKARDLQLVEQDIRAVVEA--AAGT 119 GFP+GA S KAFE + A+ +GA E+DMVINI A +A D + DI AV +A A G Sbjct: 81 GFPMGATPSDVKAFEARGAVLDGADEIDMVINIAAARAGDKGALVDDISAVADAVHAGGA 140 Query: 120 LVKVIIETSLLTDEEKVLACELSVKAGANFVKTSTGFSTGGATVEDVALMRKTVGPEIGV 179 ++KVIIET+LL+D++KVLAC+ SV+AGA+FVKTSTGF+ GGAT ED+ALMR+TVGP++GV Sbjct: 141 ILKVIIETALLSDDQKVLACQASVEAGADFVKTSTGFNGGGATAEDIALMRRTVGPDLGV 200 Query: 180 KASGGVRSLEDVQKLVEAGASRIGASSGVKIIEGEQSTSSY 220 KASGGVRSL D Q ++ AGA+RIGASSG+ I++GEQ +SSY Sbjct: 201 KASGGVRSLADAQAMIAAGATRIGASSGIAIVKGEQGSSSY 241 Lambda K H 0.313 0.127 0.340 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 241 Length adjustment: 23 Effective length of query: 197 Effective length of database: 218 Effective search space: 42946 Effective search space used: 42946 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 46 (22.3 bits)
Align candidate WP_058929608.1 AU252_RS03965 (deoxyribose-phosphate aldolase)
to HMM TIGR00126 (deoC: deoxyribose-phosphate aldolase (EC 4.1.2.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00126.hmm # target sequence database: /tmp/gapView.1897196.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00126 [M=211] Accession: TIGR00126 Description: deoC: deoxyribose-phosphate aldolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-82 261.6 6.7 2.6e-82 261.4 6.7 1.0 1 NCBI__GCF_001484605.1:WP_058929608.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_001484605.1:WP_058929608.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 261.4 6.7 2.6e-82 2.6e-82 2 210 .. 22 232 .. 21 233 .. 0.99 Alignments for each domain: == domain 1 score: 261.4 bits; conditional E-value: 2.6e-82 TIGR00126 2 lakliDhtalkadtteedietlcaeAkkykfaavcvnpsyvslAkelLkgteveictvvgFPlGasttevkll 74 +a++iDht lk+++ e++i ++caeA +y+f +vcvnp +v+ k Lk + v c+v+gFP+Ga+ ++vk++ NCBI__GCF_001484605.1:WP_058929608.1 22 IASYIDHTLLKPEASEAEILKVCAEAAEYHFKSVCVNPLWVKTVKTALKRSGVLTCSVIGFPMGATPSDVKAF 94 689********************************************************************** PP TIGR00126 75 EakeaieeGAdEvDvviniaalkdkneevviedikavveaca..kvllKvilEtalLtdeekkkAseisieag 145 Ea+ a+ GAdE+D+viniaa +++++ + ++di+av +a+ ++ lKvi+EtalL d++k+ A++ s+eag NCBI__GCF_001484605.1:WP_058929608.1 95 EARGAVLDGADEIDMVINIAAARAGDKGALVDDISAVADAVHagGAILKVIIETALLSDDQKVLACQASVEAG 167 ****************************************98889**************************** PP TIGR00126 146 adfvKtstgfsakgAtvedvrlmkkvvgdevgvKasGGvrtaedalalieagaerigasaavaii 210 adfvKtstgf+ +gAt ed++lm+++vg+++gvKasGGvr da+a+i+aga+rigas ++ai+ NCBI__GCF_001484605.1:WP_058929608.1 168 ADFVKTSTGFNGGGATAEDIALMRRTVGPDLGVKASGGVRSLADAQAMIAAGATRIGASSGIAIV 232 *************************************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (211 nodes) Target sequences: 1 (241 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 16.34 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory