Align TreU, component of Trehalose porter (characterized)
to candidate WP_058932847.1 AU252_RS08930 carbohydrate ABC transporter permease
Query= TCDB::Q97ZC1 (267 letters) >NCBI__GCF_001484605.1:WP_058932847.1 Length = 305 Score = 155 bits (391), Expect = 1e-42 Identities = 90/268 (33%), Positives = 150/268 (55%), Gaps = 6/268 (2%) Query: 3 LWVYLGAIVVGIYFLFPLYILVLLAFNSPKYTVLAKFPSLLPVSLTLNNLLTALQGTAFI 62 LW+ L A + I + FP L+ +F +P T+ P++LP TL N AL + + Sbjct: 41 LWILLAAAM--ILYGFPFLYLLFTSFKTPIDTIAVP-PTILPREWTLENYTNALGRSGVL 97 Query: 63 DPFIKSLETATLVGIITIALAIPAGYGLSRLPRAIAYSIIILLLVTNMMPAIVIGIPIAV 122 FI S +TA + ++++ LA+PA YG++R I+ LVT M+P + IGIP+A Sbjct: 98 ASFINSAQTAIISTVLSLVLAVPAAYGITRYKTPSGRVFIMAALVTRMVPPVAIGIPLAS 157 Query: 123 DFLKLHLFESVVGLALAQTLITLPLATFILQGTFSSIPIDLEHQARVDGANLFNRLFSVL 182 L ++ + L++A T I+LPL+ +++ F ++P DLE A VDG + L+ V+ Sbjct: 158 MMSAAGLADTPIALSIAHTTISLPLSIWLMSSFFEAVPQDLEEAATVDGCSRLGALWRVV 217 Query: 183 LPLAAPGIAAAFLISWMFSWDEFTYAILLIPYHS-TLPVTIYQDVTRGNLLAG--IAFSL 239 +P+ + GIA + +++ SW+EF +A+L+ S T PV I T+ L G A + Sbjct: 218 IPVVSGGIAVTAIFAFLASWNEFLFALLMTAVRSQTTPVVIANFQTQFGLDWGSMTALAA 277 Query: 240 IFTLPVIILTFALQKYLRGEYLAGGIKG 267 ++++PVI+LT LQ+ + G +KG Sbjct: 278 VYSIPVILLTLLLQRKIVAGMTLGAVKG 305 Lambda K H 0.330 0.146 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 305 Length adjustment: 26 Effective length of query: 241 Effective length of database: 279 Effective search space: 67239 Effective search space used: 67239 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory