Align Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial; MMSDH; Malonate-semialdehyde dehydrogenase [acylating]; Aldehyde dehydrogenase family 6 member A1; EC 1.2.1.18; EC 1.2.1.27 (characterized)
to candidate WP_058929155.1 AU252_RS01160 aldehyde dehydrogenase family protein
Query= SwissProt::Q02253 (535 letters) >NCBI__GCF_001484605.1:WP_058929155.1 Length = 486 Score = 209 bits (531), Expect = 2e-58 Identities = 143/476 (30%), Positives = 229/476 (48%), Gaps = 19/476 (3%) Query: 42 LFIDGKFVESKSDKWIDIHNPATNEVVGRVPQSTKAEMEAAVAACKRAFPAWADTSILSR 101 L IDG+ V + S D+ NPAT +V+ + P ++ +++ AVAA RAFPAWA T I R Sbjct: 19 LVIDGQAVSAMST--FDVFNPATGQVIAKAPDASVEQLDEAVAAAARAFPAWAATPIEER 76 Query: 102 QQVLLRYQQLIKENLKEIARLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMLGETMP 161 VL I+E+ ++ L+T EQGK A AE +++ A + P Sbjct: 77 AAVLAAIGDRIEEHSEQFMALLTREQGKPRAGAE------WEIMGSAIWCREIAKQRLTP 130 Query: 162 SITKDMD---LYSYRLPLGVCAGIAPFNFPAMIPLWMFPMAMVCGNTFLMKPSERVPGAT 218 + D D + + PLGV IAP+NFP ++ +W A++ GNT ++KPS P T Sbjct: 131 EVLVDDDNRRVTTRYTPLGVIGAIAPWNFPILLAIWKIAPAILAGNTIVVKPSPFTPLTT 190 Query: 219 MLLAKLLQDSGAPDGTLNIIHGQHEAVNFICDHPDIKAISFVGSNQAGEYIFERGSRNGK 278 + LA+L+QD P G N++ G + + HP I I+F GS + G ++ +++ K Sbjct: 191 LKLAELVQDL-LPAGVFNVVTGGDDLGKRMTSHPGIAKIAFTGSTETGRHVMASAAKSIK 249 Query: 279 RVQANMGAKNHGVVMPDANKENTLNQLVGAAFGAAGQRCMALSTAVLVGEAKKWLPE-LV 337 RV +G + +V+PD + QL AAF Q C A + + + + LV Sbjct: 250 RVTLELGGNDPAIVLPDVDPATVAPQLFWAAFQNNAQFCNATKRLYIHEDVYDVVRDALV 309 Query: 338 ERAKNLRVNAGDQPGADLGPLITPQAKERVCNLIDSGAKEGASILLDGRKIKVKGYENGN 397 E AK ++V G +P DLGP+ E+V G + L G ++ + G Sbjct: 310 EYAKTVKVGNGAEPHTDLGPIQNAPQFEKVKEFFADCNDRGYAFALGG---QIDESQPGW 366 Query: 398 FVGPTIISNVKPSMTCYKEEIFGPVLVVLETETLDEAIKIVNDNPYGNGTAIFTTNGAIA 457 F+ + + N +EE FGP+L +L+ ++ I ND +G G +++ + Sbjct: 367 FIPVSFVDNPPEDSRIVQEEPFGPILPLLKWRDEEDVISRANDTQWGLGASVWGKDEQAL 426 Query: 458 RKYAHMVDVGQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTIT 513 + A ++ G V +N + P +F G + S G N G+ YT +T T Sbjct: 427 ERIAARIEAGTVWIN-EVHQYAPNQAFGGHKQSGLGCEN--SLHGLAEYTNWQTTT 479 Lambda K H 0.318 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 543 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 535 Length of database: 486 Length adjustment: 34 Effective length of query: 501 Effective length of database: 452 Effective search space: 226452 Effective search space used: 226452 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory