Align L-iditol 2-dehydrogenase; EC 1.1.1.14 (characterized)
to candidate WP_058931176.1 AU252_RS13535 NAD(P)-dependent alcohol dehydrogenase
Query= CharProtDB::CH_000596 (353 letters) >NCBI__GCF_001484605.1:WP_058931176.1 Length = 353 Score = 319 bits (817), Expect = 8e-92 Identities = 161/349 (46%), Positives = 239/349 (68%), Gaps = 11/349 (3%) Query: 5 VPQNMKAAVMHNTREIKIETLPVPDINHDEVLIKVMAVGICGSDLHYYTNGRIGNYVVEK 64 +P M+A+V+ ++ +ETLP+P + D+VL++V AVG+CGSD+HYY +GRIG+YVV+ Sbjct: 16 LPATMRASVLKRQGDMVMETLPLPQPDADQVLVQVAAVGVCGSDVHYYEHGRIGDYVVDH 75 Query: 65 PFILGHECAGEIAAVGSSVDQFKVGDRVAVEPGVTCGRCEACKEGRYNLCPDVQFLATPP 124 P ILGHE +G IAAVGS+VD ++G+RVAVEP C C+ CK GRYNLCPD++F ATPP Sbjct: 76 PLILGHELSGRIAAVGSAVDPARIGNRVAVEPQRPCRTCKQCKAGRYNLCPDIEFYATPP 135 Query: 125 VDGAFVQYIKMRQDFVFLIPDSLSYEEAALIEPFSVGIHAAARTKLQPGSTIAIMGMGPV 184 +DGAF +Y+ ++ DF + IPDS+S E AALIEP SVG+ A R +++PGS + I G GP+ Sbjct: 136 IDGAFAEYVTIQSDFAYDIPDSVSDEAAALIEPLSVGLWACERAEIKPGSRVLIAGAGPI 195 Query: 185 GLMAVAAAKAFGAGTIIVTDLEPLRLEAAKKMGATHIINIREQDALEEIKTITNDRGVDV 244 G++A AA+AFGA I +TD+ RL A + GATH +N + D++E + VD Sbjct: 196 GIIAAQAARAFGATEIYITDIAEDRLAFALEHGATHALNAK-TDSVEGL-------DVDA 247 Query: 245 AWETAGNPAALQSALASVRRGGKLAIVGLPSQNEIPLNVPFIADNEIDIYGIFRYANTYP 304 + +G P A++S + +V G++ +VGL +++ L V +I + EI + G+FRY NT+P Sbjct: 248 FIDASGAPQAVRSGIKAVGPAGRVILVGL-GADDVELPVSYIQNREIWLSGVFRYTNTWP 306 Query: 305 KGIEFLASGIVDTKHLVTDQYSLEQTQDAMERALQFKNECLKVMVYPNR 353 I+ +A G VD LVT +++L ++++A++ Q LK +VYP R Sbjct: 307 LAIQLIADGKVDLDILVTGKFTLAESEEALKAGKQAGQ--LKAVVYPGR 353 Lambda K H 0.320 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 353 Length adjustment: 29 Effective length of query: 324 Effective length of database: 324 Effective search space: 104976 Effective search space used: 104976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory