GapMind for catabolism of small carbon sources

 

Protein WP_068463113.1 in Hyphomicrobium sulfonivorans WDL6

Annotation: NCBI__GCF_001541235.1:WP_068463113.1

Length: 361 amino acids

Source: GCF_001541235.1 in NCBI

Candidate for 90 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
putrescine catabolism potA med spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 43% 85% 238 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 41% 99% 237.3 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-mannitol catabolism mtlK med MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) 40% 84% 219.9 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-sorbitol (glucitol) catabolism mtlK med MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) 40% 84% 219.9 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-maltose catabolism malK_Bb med ABC-type maltose transport, ATP binding protein (characterized, see rationale) 45% 71% 214.9 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 44% 71% 208.4 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 44% 71% 208.4 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-cellobiose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 72% 200.3 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-glucose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 72% 200.3 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
lactose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 72% 200.3 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-maltose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 72% 200.3 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
sucrose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 72% 200.3 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
trehalose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 72% 200.3 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 41% 82% 197.2 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-histidine catabolism Ac3H11_2560 med ABC transporter for L-Histidine, ATPase component (characterized) 42% 83% 154.1 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 46% 65% 230.7 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 44% 68% 214.5 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
trehalose catabolism thuK lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 44% 68% 214.5 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 45% 64% 212.2 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 35% 98% 210.3 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
lactose catabolism lacK lo LacK, component of Lactose porter (characterized) 45% 70% 209.5 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-maltose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 36% 99% 207.6 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 36% 95% 207.2 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-maltose catabolism malK lo ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized) 38% 87% 206.5 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 39% 80% 206.1 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 39% 80% 206.1 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 39% 80% 206.1 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 90% 205.3 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 90% 205.3 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 90% 205.3 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 90% 205.3 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 90% 205.3 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 90% 205.3 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 90% 205.3 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 90% 205.3 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 42% 61% 203.8 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 42% 61% 202.2 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 38% 85% 201.4 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 38% 96% 201.1 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 44% 59% 198.7 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 43% 62% 196.4 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 36% 84% 194.5 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 36% 84% 194.5 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 37% 76% 193.4 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 38% 74% 193 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 38% 80% 193 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 96% 192.2 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 96% 192.2 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 96% 192.2 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 96% 192.2 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 77% 191.8 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 77% 191.8 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 77% 191.8 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 77% 191.8 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 77% 191.8 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 77% 191.8 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
glycerol catabolism glpT lo ABC transporter for Glycerol, ATPase component 2 (characterized) 35% 87% 174.5 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-proline catabolism opuBA lo BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized) 34% 90% 173.7 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-proline catabolism proV lo glycine betaine/l-proline transport atp-binding protein prov (characterized) 32% 84% 168.3 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-asparagine catabolism glnQ lo Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 37% 97% 161 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-glucosamine, ATPase component (characterized) 36% 92% 161 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-glutamate catabolism gltL lo Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 37% 97% 161 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-histidine catabolism hutV lo ABC transporter for L-Histidine, ATPase component (characterized) 36% 85% 159.8 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-arginine catabolism artP lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 37% 96% 159.1 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-histidine catabolism bgtA lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 37% 96% 159.1 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-lysine catabolism hisP lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 37% 96% 159.1 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 39% 61% 156.4 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 39% 67% 152.1 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-asparagine catabolism aatP lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 35% 99% 151 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-aspartate catabolism aatP lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 35% 99% 151 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 35% 94% 150.6 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 38% 92% 149.4 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 38% 92% 149.4 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 93% 148.7 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 93% 148.7 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 93% 148.7 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-histidine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 93% 148.7 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 93% 148.7 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 93% 148.7 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 35% 91% 147.9 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 35% 91% 147.9 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-histidine catabolism BPHYT_RS24015 lo ABC transporter related (characterized, see rationale) 38% 90% 146.4 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-histidine catabolism hisP lo histidine transport ATP-binding protein hisP (characterized) 34% 96% 142.9 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-asparagine catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 32% 98% 141 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-aspartate catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 32% 98% 141 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 35% 90% 140.6 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-tryptophan catabolism ecfA1 lo Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) 38% 80% 128.6 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
D-mannose catabolism TM1750 lo TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 32% 70% 127.5 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-tryptophan catabolism ecfA2 lo Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 36% 77% 124.4 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3
L-arabinose catabolism xylGsa lo Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale) 34% 96% 122.1 CysA aka B2422, component of Sulfate/thiosulfate porter 59% 336.3

Sequence Analysis Tools

View WP_068463113.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSIRVENIQRSFGAFKALDGVTLDFPTGELVALLGPSGCGKTTLLRIIAGLDFADSGRIL
LDGEDASSTHVRERKVGFVFQHYALFRHMTVFENVAFGLRVKRKGRPPDKVIRAKVMELL
KLVQLDWLADRYPAQLSGGQRQRIALARALAVGPSVLLLDEPFGALDAKVRKELRRWLRR
LHDELHITSIFVTHDQEEALELADRVVVMNRGKVEQVGAAEDVYSNPATPFVYEFLGAVN
EFRGNVVGEGLQVGTDVIPQVGRGYGNGQQVVGFARPHELDIVVDHANTNVGVPARVNRI
LSFGPVARIELSRLNGGGQTTEQQFEVQLPAQRLAELQLTTGQAVRLLSSRLRLFDQGSV
K

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory