Align Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate WP_083509610.1 APY04_RS08095 ABC transporter ATP-binding protein
Query= uniprot:G8ALJ1 (236 letters) >NCBI__GCF_001541235.1:WP_083509610.1 Length = 270 Score = 184 bits (468), Expect = 1e-51 Identities = 103/240 (42%), Positives = 147/240 (61%), Gaps = 8/240 (3%) Query: 1 MLKVSGVHTFYG-AIEALKGVDIEIGAGEIVSLIGANGAGKSTLLMTICGSPRARMGRIT 59 +L V+ + Y A+ AL GV + + GE+ +++GANGAGKST L I A G+IT Sbjct: 7 LLVVNNLAAVYNHAVSALHGVSLRVSRGEVRAILGANGAGKSTTLKAISNVLSAVRGQIT 66 Query: 60 -----FEGQDITQMPTYELVRLGIAQSPEGRRIFPRMSVLENLQMGSIT--AKPGSFANE 112 F+G D+ + +L+R G+ EGR +F ++V ENL G + + A++ Sbjct: 67 AGSIAFDGLDVAKTKPSDLIRAGLVPVLEGRHVFKSLTVEENLNTGGLGRGSSRAEIASD 126 Query: 113 LERVLTLFPRLKERISQRAGTMSGGEQQMLAIGRALMSQPRLLLLDEPSLGLAPLVVKQI 172 LERV TLFP L + AG SGGEQQM+A+GRALM++PRLL+LDEPS+GLAP+VV+ I Sbjct: 127 LERVYTLFPSLTRKRKIAAGLTSGGEQQMVAVGRALMARPRLLVLDEPSMGLAPIVVQSI 186 Query: 173 FQAVKDINREQKMTVFMVEQNAFHALKLAHRGYVMVNGKVTMSGTGAELLANEEVRSAYL 232 F ++ +NRE+ +T+ + EQNA AL+ A V+ NG + G EL +VR YL Sbjct: 187 FDTLRKLNREEGLTILLAEQNAAIALRYASSATVLENGATVLEGPADELRNRADVREFYL 246 Lambda K H 0.320 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 270 Length adjustment: 24 Effective length of query: 212 Effective length of database: 246 Effective search space: 52152 Effective search space used: 52152 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory