Align Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_083509566.1 APY04_RS07015 ABC transporter ATP-binding protein
Query= uniprot:P0DTT6 (251 letters) >NCBI__GCF_001541235.1:WP_083509566.1 Length = 392 Score = 115 bits (287), Expect = 2e-30 Identities = 76/224 (33%), Positives = 123/224 (54%), Gaps = 14/224 (6%) Query: 2 SDLLEIRDVHKSFGAVKALDGVSMEINKGEVVALLGDNGAGKSTLIKIISGYHKPDRGDL 61 S L DV ++FG +AL GVS+EI++GEVV LLG +G GK+TL++I +G +P G + Sbjct: 43 SACLTFEDVRRNFGTTQALAGVSLEIDRGEVVCLLGPSGCGKTTLLRIAAGIERPTGGRV 102 Query: 62 VFEGKKVIFNSP---NDARSLGIETIYQDLALIPDLPIYYNIFLAREVTNKIFLNKKKMM 118 + G +V S + RS+G+ ++QD AL P L I N+ + + ++ + Sbjct: 103 LINGHEVAGPSSFVVPEKRSVGL--MFQDFALFPHLTIAGNVAFGLKSLPRAEAKREALA 160 Query: 119 EESKKLLDSLQIRIPDINMKVENLSGGQRQAVAVARAVYFSAKMILMDEPTAALSVVEAR 178 + L+ + P + LSGGQ+Q VA+ARA+ ++LMDEP + L V+ R Sbjct: 161 ALKRVGLEHMADEYPHV------LSGGQQQRVALARALVPRPAVMLMDEPFSGLD-VQLR 213 Query: 179 KVL--ELARNLKKKGLGVLIITHNIIQGYEVADRIYVLDRGKII 220 + E L++ G +++THN + + DRI V+ G +I Sbjct: 214 DAMQEETLSLLRETGATAMVVTHNPEEAMRIGDRIVVMRAGGLI 257 Lambda K H 0.318 0.137 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 392 Length adjustment: 27 Effective length of query: 224 Effective length of database: 365 Effective search space: 81760 Effective search space used: 81760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory